KEGG   Shewanella khirikhana: STH12_04045
Entry
STH12_04045       CDS       T06711                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
skh  Shewanella khirikhana
Pathway
skh00471  D-Glutamine and D-glutamate metabolism
skh00550  Peptidoglycan biosynthesis
skh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    STH12_04045 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH12_04045 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
    STH12_04045 (murC)
Enzymes [BR:skh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     STH12_04045 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:skh01011]
 Precursor biosynthesis
  Amino acid ligase
   STH12_04045 (murC)
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-ProteinID: AZQ13079
UniProt: A0A3S9LC23
LinkDB
Position
4582326..4583780
AA seq 484 aa
MTQTEKYRQLRTMIPEMRRVRRIHFVGIGGAGMGGIAEVLVNEGYQVSGSDIANNAVTER
LGGLGARIFIGHGADNVAGVDVVVVSTAINKENPELLAAKANRIPVVRRAEMLAELMRYR
HGVAVAGTHGKTTTTSLIASIYGQADRDPTFVIGGLLNSAGTNARLGSSRYLIAEADESD
ASFLHLQPMVTVVTNIEADHMDTYGGDFEKLKSTFVDFMHNLPFYGVAVVCVDDPVVREL
IPRIGRQVVTYGFSDDADVQALDFVQEGHSCRFTVRRKGKDDLSLKVNLPGQHNVLNSLA
AIAVATEDEIEDEAIVKALGEFQGIGRRFQHLGKFDTPKGEVMLVDDYGHHPSEVAATIK
AARAGWPDKRLVMAYQPHRYTRTRDLYEDFVEVLSQVDKLVLLEVYAAGEAPIPGADGRA
LCRSIRQRGQLEPIFVASPDQLAAVMPDVLEDGDLLLCQGAGNIGALSRELAASQLGFDK
ADNN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgacacagacagagaagtacagacagcttcgtaccatgatccccgagatgcgccgggtg
cgccgaatccactttgtgggcattggcggcgccggtatgggtgggattgccgaagtgctg
gtgaacgaaggctatcaggtcagcggctcagatatcgcgaacaatgccgtgaccgagcgt
cttggtggtctgggtgcccgtatttttatcggccatggtgccgacaatgtagcaggcgtg
gacgtggtggtggtatccaccgccatcaacaaagaaaacccggaattgctggctgccaag
gccaatcgtattcctgtggtgcgccgcgccgaaatgctcgccgagctgatgcgttatcgc
catggggtggcggtggccggtacccacggtaaaaccactaccaccagtttgattgccagc
atttatggtcaggccgaccgtgacccaacctttgtgattggtggtctgctcaacagcgca
ggtaccaacgcccgtttgggttcgagccgttatctgattgccgaggctgacgagagtgat
gccagcttcctgcatctgcagccaatggtgactgtggtgaccaatatcgaagccgaccac
atggatacttacggcggcgacttcgagaagctcaaatccaccttcgtggactttatgcac
aatctgccgttttacggcgtggccgtggtctgtgtggacgaccctgtggtgcgcgagctg
atcccgcgcattggccgccaggtagtgacctacggcttcagcgacgatgccgatgtgcag
gcgctggattttgttcaggaaggccacagctgccgctttaccgtgcgccgcaagggcaaa
gacgatttgtcgctgaaggtgaatctgcctgggcagcacaatgtgctcaactctctggct
gcgattgcggtggcgaccgaggatgaaattgaagacgaggctatcgtcaaggcgctgggc
gaattccagggcattggccgccgcttccagcacctgggtaagttcgatacccccaagggc
gaagtgatgttggtggacgactatggtcaccatcccagcgaagtggccgctaccatcaag
gctgcccgcgcgggttggccggacaagcgtctggtgatggcctatcagccgcaccgttat
acccgtacccgggacctgtacgaagacttcgtcgaggtgctgtctcaggtcgataagctg
gtgctgcttgaagtgtatgccgccggtgaagcgccaatccccggcgccgatggccgggcc
ctgtgccgctcgattcgtcagcgcggtcagctggaaccgatttttgttgccagccccgac
caactcgcggcggtgatgccggacgtgctggaagatggcgatctgctgctgtgtcagggg
gcgggcaatatcggtgccctgtcccgtgagctggcggcgagccaactggggttcgacaag
gcggacaacaactag

DBGET integrated database retrieval system