KEGG   Staphylococcus kloosii: C7J89_00580Help
Entry
C7J89_00580       CDS       T05401                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
skl  Staphylococcus kloosii
Brite
KEGG Orthology (KO) [BR:skl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7J89_00580
Enzymes [BR:skl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7J89_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 Thi4 AlaDh_PNT_C DAO FAD_oxidored K_oxygenase NAD_binding_9 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AVQ34706
UniProt: A0A512QEX8
LinkDB All DBs
Position
119515..121041
Genome map
AA seq 508 aa AA seqDB search
MLNDELKSQLKQLLQLMEGDVELRASLGSDDKSKELKELLDEVSSMSSNISVEEADLKRT
PSFTVNRPGEDTGITFAGLPMGHEFNSLVLALLQVSGRPPKEEQAVIDQIKALDRPLHFE
TYISLTCQKCPDVVQALNLMSLLNPNITHTMIDGAIFKEESENIMAVPAIFLNGEEFGNG
RMSVQDILTSLGSQADPSEFNDKAPYDVLILGGGPASGTSAIYTARKGLRTGIVADRIGG
QVNDTAAIENFVTVKETDGPKFSSALEDHIKQYDDIDVMTGVRASGIEKTDDDIVITLDN
DAQLHSKTVIIATGARWRKLQVPGEDELINKGVAFCPHCDGPLFEGKDVAVVGGGNSGVE
AAIDLAGIVKHVTLLERNAELKADDVLQQRLNSLSNVTVIKQAQTTEVIGEDSVTGLKYN
DISTNEEHTIELDGIFVQIGLLPNTEWLDEYVELNEAKEITIDRKNATSVPGIFAAGDVT
DDRNKQIIISMGAGANAALNAFDYIIRH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgatgagttgaaatcacaacttaagcaattacttcaattaatggaaggtgac
gtagaattaagagcaagtcttggttctgacgataaatctaaagagttaaaagaactttta
gatgaagtttcaagcatgtcatctaacattagtgtagaagaagctgatctaaaacgtacg
cctagctttacagtaaatcgtccaggcgaagatactggcattactttcgcaggtttacca
atgggtcacgaatttaactcacttgttctagctttattacaagttagtggtcgcccacca
aaagaagaacaagcagttatagatcaaatcaaagcactagaccgtccactacattttgaa
acttatatcagtttaacttgtcaaaaatgtcctgacgtagtccaagctttaaatttaatg
agtttattaaaccctaatatcactcatacaatgattgacggagctatctttaaagaagaa
tccgaaaatatcatggctgtccctgctattttcctaaatggagaagagtttggaaatggc
cgtatgtcagtacaagatattctaactagtttaggtagccaagctgacccatctgaattt
aacgacaaagcaccttacgatgttttaatccttggcggtggccctgcaagtggtacttct
gccatttatacagctcgtaaaggattacgcacaggtatcgttgctgaccgcattggcgga
caagttaatgatactgctgctattgaaaactttgtaacagttaaagaaacagatggacca
aaattctcatctgctttagaagatcatattaaacaatatgatgatatcgatgttatgact
ggcgttcgtgctagtggtatcgaaaaaacagatgatgacatcgttattactttagataac
gatgcgcaattacacagtaaaactgtaattattgctactggtgcacgttggcgtaaacta
caagttcctggtgaagatgagcttatcaataaaggtgtagcattctgtcctcactgtgat
ggccctttattcgaaggtaaagatgttgcagttgtcggcggaggtaactctggcgttgaa
gctgccattgatttagcaggaatagttaaacatgtaactttattagaaagaaatgcagag
ttaaaagctgacgatgtattacaacaacgattaaactctctatcaaacgtaacagttatt
aaacaagctcaaactaccgaagttattggtgaagattcagtaactggtttaaaatataat
gatattagtacaaatgaagagcataccattgaattagacggtattttcgttcaaattggc
ttattacctaacactgaatggttagatgaatatgtagaattgaatgaagctaaagaaatt
acgattgaccgtaaaaatgcgacaagtgttcctggcatatttgccgctggtgacgtaaca
gatgaccgtaataaacaaatcattatttcaatgggtgcaggcgcaaatgctgcattaaat
gcttttgattatattattcgtcactaa

DBGET integrated database retrieval system