KEGG   Staphylococcus kloosii: C7J89_01610
Entry
C7J89_01610       CDS       T05401                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
skl  Staphylococcus kloosii
Pathway
skl00040  Pentose and glucuronate interconversions
skl00051  Fructose and mannose metabolism
skl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C7J89_01610
   00051 Fructose and mannose metabolism
    C7J89_01610
Enzymes [BR:skl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     C7J89_01610
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox ADH_N_2 Mur_ligase_C
Other DBs
NCBI-ProteinID: AVQ34899
LinkDB
Position
312699..313772
AA seq 357 aa
MAQQIPQKMNISLLNKPFDMELKEVDVPEIGPHDVLVKVMAVGVCGSDVHYYEHGRVGEF
VVEKPLILGHECAGIVADVGSAVTKFKVGDRVAIEPGVTCGECEYCKAGQYNLCPHVEFL
ATPPIDGAFSQYISHPEGFLFHIPDSMTYEQATLNEPFSVGIQACKRANVQPGSTVVIMG
MGPVGLMAVVAAKAFGATNIIVSDLEQIRLDEALKLGATHAIDIKKEDVNERIKEITDGD
GVNYAIETAGNPTALKNALGSLKNGGTLAIVGLPQQETNDLNIPFIANHEINIVGIFRYA
NTYQMGVEMLNSTAADLDSMFTDEYNLEDAQQAMEQARTNKSGSLKVMVYPNGKPVE
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcacaacaaataccacaaaaaatgaacatttcattacttaataaacctttcgatatg
gaattaaaagaagtagacgtaccagaaattggaccacatgatgtcttagtcaaagttatg
gctgtaggcgtttgtggttcagacgttcactattatgaacacggcagagtaggagaattc
gtcgtagaaaaaccacttattttaggccatgaatgtgcaggcatcgttgcagacgtcgga
tcagcagtaactaaatttaaagtaggtgaccgagtagcaatcgaaccaggagtaacatgt
ggggaatgtgaatactgtaaagcaggacaatataatctttgcccacacgtagaattttta
gcaacaccaccaatcgatggcgcattcagtcaatatattagccatccggaaggcttttta
ttccacattcctgattcaatgacatacgaacaagcaacattgaatgaaccattttcagta
ggcattcaagcatgtaaacgtgcaaacgttcagccaggttcaacggtagtcattatgggt
atgggaccagttggcttaatggctgtcgttgcagctaaagcctttggtgcgactaatatt
atcgtgtctgacctagaacaaatccgtttagacgaagcattaaaactcggtgcgacacac
gcaattgatattaaaaaagaagacgttaacgaacgcattaaagaaatcacagatggtgac
ggcgtaaactacgccattgaaactgcaggtaatccgacagcactaaaaaatgcattaggt
tcattaaaaaatggcggtacacttgctatcgttggtttaccacaacaagaaacaaacgac
ctaaatatcccatttattgctaaccatgaaattaacatcgtaggtattttcagatatgcc
aacacatatcaaatgggtgtagaaatgttaaattcaacagctgcagatctagattcaatg
tttacagatgaatacaatttagaagatgcacaacaagctatggaacaagcacgtacaaac
aaaagcggttcattgaaagtgatggtttatccaaatggcaaacctgtagagtaa

DBGET integrated database retrieval system