KEGG   Staphylococcus kloosii: C7J89_02890Help
Entry
C7J89_02890       CDS       T05401                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
skl  Staphylococcus kloosii
Brite
KEGG Orthology (KO) [BR:skl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    C7J89_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AVQ35132
UniProt: A0A151A2Q7
LinkDB All DBs
Position
607168..607956
Genome map
AA seq 262 aa AA seqDB search
MTIVVLILIGMISAIIGSLIGVGGGIIIVPTLVYLGSKTDLLTGITTQTAVGISSLTLVF
TGLFSIIAYRKKGKNTIDLKNGFLFSIGIIPGSLVGAYLSRFLNDVYFNIIFGIFLFIIS
IVLIVKDYLAAKKSSDAEKKVNTPVAIIFSFFVGISAGLFGIGGGVLMTPLMIIAFNFSP
HVAVATSMIIIFTSSLASTLGHVVQGHVIWHYGLVLIIASYIGTKIGVTINRSIDSAKLS
NLLKIVLILMSIYLIYKGFSSL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgtagtgttaatcctgattgggatgatatcagctataataggttcattaatc
ggtgtaggtggcggtatcattatcgttccgacattggtttatttaggttctaaaacagat
ttgcttacaggtattacgacacaaacagcagtcggcatttcatcgttaactttagtcttt
acaggtctgttttcgatcatagcttatcgtaagaaaggtaaaaatacgattgatcttaaa
aatggttttttattttcaattggaattataccgggttcattggtaggcgcgtatttaagt
cgctttttaaatgatgtctactttaatattatttttggtatttttctatttatcatttca
atcgtattaatagtgaaggattatttagcggctaaaaaatcttcggatgctgaaaaaaag
gtcaacacaccggtagcaataatcttttcattctttgtcggtattagtgcagggctcttc
ggtataggtggaggcgttttaatgacgccattaatgattattgcatttaatttttcacca
cacgtggcagtggctaccagcatgattattatctttacttcaagtttggcaagtacgtta
gggcacgtcgttcaaggacatgttatctggcattatggtttagtattaatcattgcaagt
tatatcggtactaaaatcggtgtgacgattaaccgcagtattgattcggccaagctttca
aacttacttaaaatagtattgatattaatgagtatttatttaatttataaaggttttagc
agtttataa

DBGET integrated database retrieval system