KEGG   Staphylococcus kloosii: C7J89_05365Help
Entry
C7J89_05365       CDS       T05401                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
skl  Staphylococcus kloosii
Pathway
skl00010  Glycolysis / Gluconeogenesis
skl00053  Ascorbate and aldarate metabolism
skl00071  Fatty acid degradation
skl00280  Valine, leucine and isoleucine degradation
skl00310  Lysine degradation
skl00330  Arginine and proline metabolism
skl00340  Histidine metabolism
skl00380  Tryptophan metabolism
skl00410  beta-Alanine metabolism
skl00561  Glycerolipid metabolism
skl00620  Pyruvate metabolism
skl00625  Chloroalkane and chloroalkene degradation
skl01100  Metabolic pathways
skl01110  Biosynthesis of secondary metabolites
skl01120  Microbial metabolism in diverse environments
skl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:skl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C7J89_05365
   00053 Ascorbate and aldarate metabolism
    C7J89_05365
   00620 Pyruvate metabolism
    C7J89_05365
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C7J89_05365
   00561 Glycerolipid metabolism
    C7J89_05365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C7J89_05365
   00310 Lysine degradation
    C7J89_05365
   00330 Arginine and proline metabolism
    C7J89_05365
   00340 Histidine metabolism
    C7J89_05365
   00380 Tryptophan metabolism
    C7J89_05365
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C7J89_05365
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C7J89_05365
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C7J89_05365
Enzymes [BR:skl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C7J89_05365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AVQ35606
LinkDB All DBs
Position
1104297..1105724
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWIDSTSGETIEVVNPATEEVIGSIAKGNKEDVDKAVEAAENVYIDFRH
SSVKERRDLLDKIVQEYKNRKDDIVEAIRDELGSPVTNAEKVHYQMGLDHFEAARDALDD
FEFEERRGNDLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGNPISEHPSIRIVSFTGSGGTGSKIMEKAAKDFK
KVSLELGGKSPYIILEDADIEDAAAAAVKKVIGNTGQVCTAGTRTLVPESIKADFLTAVK
EKMSQIKVGDPTDASTEMGPIISKKQFDQVQAYIDKGINEGAELFYGGPGKPEGLEKGYF
ARPTIFNNVDNKMTIAQEEIFGPVMSIISYNNLDEAIKIANDTKYGLASYVFGKDKEQLE
KVARSMEAGTVEINEAGRKPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGFYN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacttcactaagcaatatattaacggtgaatggatagacagcacgagcggtgaa
acaattgaagttgttaaccctgcaactgaagaagttatcggttcaattgcaaaaggtaat
aaagaagatgttgataaagcagtagaagctgctgaaaatgtatatattgacttcagacat
agttctgttaaagaaagacgcgatcttttagataaaatagtacaagaatataaaaataga
aaagatgacattgtagaagcaattagagacgaattaggttctccggttactaatgcagaa
aaagtacattaccaaatgggactagatcattttgaagctgcacgtgacgcactagatgat
tttgaatttgaagaacgtcgtggcaatgatttagtagttaaagaagctattggtgtagca
ggattaattacaccatggaacttcccaactaaccaaacttcattaaaattagctgctgca
tttgctgcaggtagtccagttgtattaaaaccatctgaagaaacaccatttgctgcaatt
atcttagctgaaatttttgataaagtaggcgtacctaaaggtgtattcaaccttgtaaat
ggtgacggtgaaggcgttggtaacccaatcagtgaacacccaagcattagaatcgtatca
tttactggttctggcggtactggttctaaaattatggaaaaagctgctaaagacttcaaa
aaagtatcacttgaattaggtggtaaatcaccatatattattttagaagatgcagatatc
gaagatgcggctgcagctgcagttaaaaaagtaattggtaacactggtcaagtttgtact
gctggtacaagaacattagttccagaaagtattaaagctgatttcttaactgctgttaaa
gaaaaaatgagccaaattaaagtaggcgaccctacagatgcatcaactgaaatgggtcca
attattagtaaaaaacaattcgaccaagttcaagcatatattgataaaggtatcaacgaa
ggtgcagaactattttatggtggtccaggtaagccagaaggcttagaaaaaggttacttt
gctagaccaactatatttaataatgttgataataaaatgacaattgctcaagaagaaatt
tttggaccagtaatgtctatcattagttacaacaatttagacgaagctattaaaattgct
aatgatactaaatacggacttgcaagctatgtatttggtaaagataaagaacaattggaa
aaagttgcacgttcaatggaagctggaacagttgaaattaacgaagcaggtcgtaaacca
gacttaccattcggtggttataaacaatcaggtattggccgcgaatggggcgactatggt
attgaagaattcctagaagttaaatctattgcaggattttacaattaa

DBGET integrated database retrieval system