KEGG   Spiroplasma kunkelii: SKUN_00381Help
Entry
SKUN_00381        CDS       T04056                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
skn  Spiroplasma kunkelii
Brite
KEGG Orthology (KO) [BR:skn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:skn01001]
    SKUN_00381
Enzymes [BR:skn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SKUN_00381
Protein kinases [BR:skn01001]
 Serine/threonine kinases: Other
  Bacterial family
   SKUN_00381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ALA97297
UniProt: A0A0K2JFW2
LinkDB All DBs
Position
332549..333571
Genome map
AA seq 340 aa AA seqDB search
MQKMEQITIGAVLHNRYHVLAKIADGGMAEVFEGYDMLLKRHVAIKIMTLTLSKNKEAVE
RFNKEYNSIAQFSHNNVVKVYGSFQAYNRHCLVLELVKGYTLKDRLLTLGPCTVKELLYF
FDEINLAITEAHHNDIIHRDIKPENILISYDGKIKVADFGVAILENSEDLECGKIIGTSK
YMAPEIVQSKPATKRTDIYALGIMLYELAVGMAPFVGKNPTFVAVKHVKELPLRPRLVNP
LIPQSLENVILKAIAKDPSERFQTVVDFNTSLQAIETSEHRSEKPLKLSNMFEVKGKQCK
LYDRYYSYSWFLRIKVAWWFSFLLVCFIIALVCLCLFLPG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaatggaacaaatcacaattggagcagtgttacacaatcgttatcatgtttta
gctaaaattgcagatggtggtatggctgaagtttttgaaggatatgatatgttattaaag
cggcatgttgcaattaaaattatgacattaacattatcaaaaaataaagaagcagtagaa
cgttttaataaagaatataactcaattgcgcagttttcccataataatgtggtcaaagtt
tatggttcatttcaggcgtataatcgtcattgtttagttttggaattagttaaaggttat
actttgaaagatcgtttactaacattaggtccttgtactgttaaagaattattatatttt
tttgatgaaattaatttagctattacggaagctcatcataatgatattattcatcgtgat
attaaaccagaaaatattttgatttcatatgatggtaaaatcaaggttgctgattttggg
gttgcaattttagaaaatagtgaagatttagaatgtggcaaaatcattggaacatcaaaa
tatatggcgccagaaattgttcaatcaaaaccagcaacaaaacgcactgatatttatgct
ttagggattatgttatatgagttagcggttgggatggctccttttgttggaaaaaatcca
acttttgttgcagttaaacatgttaaagaattgccactacgaccacggttagtaaatcct
ttaatcccacaaagtttagaaaatgttattttaaaagcaattgcaaaagatcctagtgaa
cggtttcagacagtagtagattttaatactagtttacaagcaattgaaacatcagaacat
cgctcggaaaaacctttaaagttatcaaatatgtttgaagtaaaaggtaagcagtgtaag
ctttatgatcggtattattcttattcatgatttttaagaattaaggttgcttgatgattt
agtttcttactagtttgtttcattattgccttagtttgtctttgcttgtttttaccaggg
tag

DBGET integrated database retrieval system