KEGG   Saccoglossus kowalevskii (acorn worm): 100313711Help
Entry
100313711         CDS       T04123                                 

Gene name
Pten
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00562  Inositol phosphate metabolism
sko01100  Metabolic pathways
sko04068  FoxO signaling pathway
sko04070  Phosphatidylinositol signaling system
sko04140  Autophagy - animal
sko04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100313711 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100313711 (Pten)
   04070 Phosphatidylinositol signaling system
    100313711 (Pten)
   04150 mTOR signaling pathway
    100313711 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100313711 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sko01009]
    100313711 (Pten)
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100313711 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     100313711 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100313711 (Pten)
Protein phosphatases and associated proteins [BR:sko01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100313711 (Pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase CDKN3 DSPn
Motif
Other DBs
NCBI-GeneID: 100313711
NCBI-ProteinID: NP_001161638
UniProt: D1LXC1
LinkDB All DBs
Position
Un
AA seq 399 aa AA seqDB search
MASKIKNLVSKKKRRYQEGGFDLDLSYIYPNIIAMGFPAEKIESYYRNSIDDVVRFLDLK
HKDHYKIYNLCSERCYDISKFRNRVVHYPFDDHHPPKLELIKTFCEDVDEWLRKNEANVA
VIHCKAGKGRTGVMICSYLIHIGKFLSAQKALEYYGKTRTLNEKGVTIPSQRRYVEYYEF
LRLKCVGDYKQTTLLLKTIHFDTVPMFSGGVCNPYFVVSQQKVKIYSSPSYESKRGDKFI
KCDVTPPLPICGDIKIEFFHKTNMLTKREKMFHFWFNTFVISAGEKVSNGATGSEGDDCD
ILTLTLRKDEIDKANKDKTNKNFSPNFKVRLIFSTVDEQSEQSEATKAVDGCTNTGGLDG
QELSSGSGDDVLHTDDENLSDTDEEEEWTGVDSSSSVCC
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagatcaagaatctcgtcagcaagaagaagcgacgatatcaagaaggtggc
tttgacctggatcttagctatatctatcccaatattatagctatgggcttcccagctgag
aaaattgagagctattatagaaatagtattgatgatgttgtcagattcttggatttaaag
cataaggaccactataaaatatataatttgtgttcagaaagatgttacgatatatccaaa
ttccgaaatagagttgtacattatcctttcgatgaccatcatcctcccaagttagaactt
ataaaaacattttgtgaagatgttgatgagtggttacgcaaaaatgaggctaatgtagct
gtaattcattgtaaagcaggcaagggtaggacaggggtgatgatttgttcctatttaatt
catataggaaagtttctcagtgctcaaaaggcgttagaatattacggaaaaactagaacc
ctaaatgaaaagggagttacgataccaagtcaaaggcgttatgtggaatactatgaattt
ttaaggctaaaatgtgtaggtgattacaagcaaacaacgttgttacttaaaacaattcac
tttgatacagttcctatgttttcaggtggagtgtgtaatccatattttgtcgttagtcaa
caaaaagttaaaatttattcttcaccttcttatgaaagtaagcgaggtgataaatttatt
aaatgtgatgttacaccgccactgccaatatgtggagatattaaaatagaattttttcat
aaaacaaacatgcttacaaaaagggaaaaaatgtttcatttttggttcaacacatttgtg
atatcagctggtgaaaaagtctcaaatggagcgacgggaagtgagggcgacgactgcgac
atcttaacactaacacttagaaaagatgaaattgacaaagctaacaaagataaaacaaat
aaaaatttctcaccaaatttcaaggtgcgattaatattcagcactgtggatgagcagtcg
gaacaatcagaagcaacaaaagctgtggatggttgtactaacactggaggactagacgga
caagaactaagcagtggcagtggagacgatgttttacatacggatgatgagaacttatca
gatacagatgaggaggaagaatggacaggtgtagattcttcctctagtgtttgctgttga

DBGET integrated database retrieval system