KEGG   Saccoglossus kowalevskii (acorn worm): 100329004
Entry
100329004         CDS       T04123                                 

Gene name
TGFbRII
Definition
(RefSeq) transforming growth factor-beta receptor type 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04068  FoxO signaling pathway
sko04144  Endocytosis
sko04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100329004 (TGFbRII)
   04068 FoxO signaling pathway
    100329004 (TGFbRII)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100329004 (TGFbRII)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100329004 (TGFbRII)
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100329004 (TGFbRII)
Protein kinases [BR:sko01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100329004 (TGFbRII)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH
Other DBs
NCBI-GeneID: 100329004
NCBI-ProteinID: XP_006815858
LinkDB
Position
Un
AA seq 457 aa
MRSVVNFVNSGSKSAIYESVLMSDLLPHESEKDSNDNLSVQLDGLLARGQFAQIWKGSMV
KDGIQRPVAVKIFSPDQYKSWAQETEFYTDLRVSLRHSHILEYITSRENINGTPQQHWII
TAYHEHGSLRDYLTKYVISWNELCTMGKTLMSGLAQLHSYSTGQDYIPKIPVAHRDMKSS
NVLVKCDGTCAIADFGLAMKLDPLTSIDELANMGQVGTPRYMSPEALDCKINLADIESFK
HCDMYSVALIIWEMMSRCSISSTMGDYKLPYSDHVPSNPSIEMMKGVLIRDKRRPDVPAS
WNEHKGMRSLVDTMVDCWDDDPDARLTASCVEFRLGNLSRLDDADFDIFGETRLLDEIDS
GMASSTSQVTSSRESTVSSPLHKPRKGPRSTATTRPSVTSEFSDESGMSEVVSPSHRSQR
CYKKSFNSDISEENEIIELVNDDDLPMFRQSILISIE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcgcagcgtggttaactttgtgaattcggggtctaaaagtgctatttatgaatccgtc
ctaatgtctgacctgctgccacatgaatctgagaaagactcgaatgataatttatcagtg
caactggacgggctgcttgcccggggacaatttgcacagatatggaaaggcagtatggtt
aaagacggtattcagaggcccgtcgcggtcaagatcttttccccagaccaatacaaaagt
tgggctcaagaaacagaattttacacagacttaagagtttcactgagacattcccacatt
ttggagtacatcacaagtcgtgaaaatataaacggaaccccacaacaacattggataatc
actgcctaccacgaacacggatcactccgcgattatctaacgaaatacgtcatttcttgg
aatgaactttgcactatgggtaaaacgctgatgtcaggtttagcacaattgcattcgtac
tcgacagggcaggattatattccaaaaattcctgtcgcacacagggatatgaaaagttcc
aatgttttagtgaaatgtgacgggacatgtgctattgctgacttcggactggccatgaaa
ttggacccactcacttcaattgacgaacttgctaatatgggacaggtgggaacacctcga
tatatgtcgcccgaggcgctggactgcaagattaatttggctgatattgagtcttttaaa
cattgcgatatgtattctgttgcattgatcatatgggaaatgatgtcacgatgttccatc
tcgtcaacgatgggagactataaacttccatacagtgatcacgtgcctagcaacccctcg
attgaaatgatgaaaggcgtgttgatacgcgacaagagaagaccagacgtgccggcctca
tggaatgaacacaaggggatgcgttctttggtcgatacaatggtcgattgttgggatgac
gacccggatgctcgcctcactgcctcgtgcgtggaattcagattgggcaatctttctagg
ctggacgatgccgattttgacatattcggggaaacacgattattggacgaaattgactca
ggaatggcgtcgtcgacatcacaagtgacgtcatcaagggaatcaactgtaagcagtcct
ttgcataaaccacgaaaaggtccgaggagcacggcgactaccagaccgtctgtgacgtca
gaattcagtgacgaaagtgggatgtcagaagttgtaagtcccagtcaccgcagtcagcga
tgttataaaaaatctttcaactcggatataagtgaagaaaatgaaattattgaacttgtc
aatgatgatgatttgccaatgtttagacaatcgatactcatttctatagagtaa

DBGET integrated database retrieval system