KEGG   Saccoglossus kowalevskii (acorn worm): 100366661Help
Entry
100366661         CDS       T04123                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00052  Galactose metabolism
sko00500  Starch and sucrose metabolism
sko01100  Metabolic pathways
sko04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100366661
   00500 Starch and sucrose metabolism
    100366661
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100366661
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    100366661
Enzymes [BR:sko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100366661
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100366661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100366661
NCBI-ProteinID: XP_006817350
LinkDB All DBs
Position
Un
AA seq 870 aa AA seqDB search
AVFWECSSSVFSMKSSHSCYIIATIVRMSRCLALVVFLLVAGRAHTQQCNVDDNVRFDCF
PEDGVTQSKCEARGCCWRLPKSSGNHTTPPRRGGRLLPTQDVPYCFYPSDYPTYSLSNLK
ETDYGYTGDLRRSTHSYYPKDIMQLKLDVYFETNTRLHFKIYDANSQRYEVPIETPKVTK
KVPRPNYEVDFVHEPFSLRVARFDSGQGMNETLFNTNITRSFMFTDQFIQISSILPTSYI
YGLGEHRAGFLHSLNWTRLTMWARDIPPVYVFLGPSPDQVIQQYTEVIGRPFMPPYWSLG
FHLCRWGYGSSDKTQQVVEKMRKAGIPQDGQWNDIDYMDKHLDWTYDKTNFSGLSDVVKD
LHDHGQHYVNIIDPGISNQQPKGSYAPYDDGLSIGAFITFANGSLVKGQVWPGETVYPDF
TNPVTKVWWTAEAKAYHDKINYDGLWIDMNEPSNFVDGSILGCPDNSYEHPPYTPDVLGD
KLSAFTVCVSAKQYWSTHYNVHNLYGMSEMIASHDALANIRGKRPLVISRSTFPSSGKYG
GHWLGDNNSLWKDMWYSIPGILNFNLFGIPLVGADICGFGGTTTEELCQRWQQLGAFYPF
SRNHNTLGSKDQDPTSFSPAMQKSTRDILLIRYSLLPYLYTLFHKGHVTGSTIVRPLFFE
FSMDQEAFTIDRQFLWGSSLLISPVLEENATSVNAYFPADTWYDFYTGTRVTSQPSKGKM
ITLDAPLDKLNLHVRGGRILPTQDPNTTTTASRNNKYGLIVAMSMGSVANGELFWDDGDT
LSTYENGKYIFMKFSAVDNKITSTVIKNGYPYADKMELGSTRVFGVAKQPTSVSANGKAA
TFTYDSKTQMLTVSDMSLPMKVPINITWKY
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
gctgtattctgggaatgctcttctagtgttttcagcatgaaatcgtcacatagctgttac
atcatcgccaccattgtccgtatgtctcggtgtctggcattggtcgtcttcctcctggtc
gcaggacgggcccacacacaacagtgcaacgttgatgacaatgttcgatttgactgcttt
cctgaagacggtgttactcagtctaaatgtgaagcacggggttgttgttggagacttcct
aaatcatctggaaaccacactactcctccccgccgtggaggtagactacttcctacacaa
gatgtgccatactgtttttatccatctgactaccctacgtatagtctgtctaatttgaaa
gaaacagattatgggtatactggtgatctgaggagaagcactcacagctattacccaaaa
gacatcatgcagttaaaacttgatgtttattttgaaacaaatactcgactacacttcaag
atttatgatgctaatagtcagagatatgaagtacccatcgagacaccaaaggttactaag
aaggtgcctcgtccaaattatgaagtggacttcgtgcatgagccattcagtttaagagta
gccagatttgactcgggacaaggaatgaatgagactttatttaataccaatattacaaga
tcatttatgtttactgatcagtttattcaaatctcgtcaattctaccaacttcttacatt
tatggtttgggtgaacacagagcaggatttcttcacagtcttaactggacaaggttaaca
atgtgggccagagatataccacctgtgtatgtattcttgggtcccagtcctgatcaggtg
atacagcaatacactgaggtgattggccgaccgtttatgccgccatattggagtctggga
tttcatctatgcaggtgggggtatggcagttctgataaaacacagcaagtagtagagaaa
atgagaaaagctggaatacctcaggatggccaatggaatgacattgattatatggataaa
catcttgattggacgtatgataagacaaacttttctggtttaagtgatgttgtgaaagat
ctacacgaccatggacaacattatgttaatatcattgatccaggcatcagtaaccaacaa
cctaaggggtcttatgccccttatgatgatggtttgtcaattggagcattcattactttt
gctaatggttcacttgtgaaaggccaggtatggcctggtgagactgtgtacccagatttt
accaacccagtcacaaaagtatggtggacagctgaagccaaggcgtatcatgataaaatc
aattacgatggtttatggattgatatgaatgaaccttctaattttgttgatggatcaata
cttggttgccccgacaacagttatgaacacccaccatatacaccagatgtacttggcgat
aagttatcagcatttactgtatgtgtatcagccaagcaatactggtcaacacattataat
gtacataatttatatggaatgtcagaaatgatcgcttcccatgatgcccttgctaacatc
agaggaaagcgaccgttagtgatatcacgatctacgttccctagtagtggcaaatatggt
gggcattggttgggagataataacagtttgtggaaagatatgtggtattcaataccgggt
atactaaatttcaacttgtttggtattccattggttggtgctgacatatgtggttttggt
ggtaccaccacagaagaactttgccaaagatggcagcaactaggagctttttatccattc
tcacgaaatcacaacacactggggtcaaaggatcaagaccccacgtcatttagtccagca
atgcagaaatctaccagagatattcttctcattagatattcattattaccatatctatat
actttattccacaaaggtcatgtgactggttcaaccattgtcagaccactattttttgaa
ttctcaatggaccaagaggccttcaccattgacagacagtttctgtggggatcatcttta
ctcatatcaccagtattagaggagaatgcgaccagtgtcaatgcttattttccggctgac
acctggtatgatttttacactggtacaagagtgaccagtcaaccaagtaaaggaaaaatg
ataaccctagatgctccgctagataaacttaacctacacgtgagaggcggccgtatcttg
ccgacacaggatcctaataccaccactactgctagtagaaataacaaatatggactgatt
gtagcaatgtcgatgggttctgtagctaatggagagttattctgggatgacggcgacaca
ttaagtacttatgaaaatggcaaatacatatttatgaagttttcagctgttgataataaa
atcacttccactgttattaaaaatggatatccatatgctgataaaatggagctgggttca
acaagagtgtttggtgttgctaagcaaccaaccagtgtttcagccaatggtaaagcagca
acttttacatatgatagcaaaacacagatgttgactgtatcggacatgtcattgccaatg
aaggtgccaataaacatcacttggaagtattga

DBGET integrated database retrieval system