KEGG   Saccoglossus kowalevskii (acorn worm): 100367300Help
Entry
100367300         CDS       T04123                                 

Definition
(RefSeq) peroxisomal multifunctional enzyme type 2-like
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko01040  Biosynthesis of unsaturated fatty acids
sko01100  Metabolic pathways
sko01212  Fatty acid metabolism
sko04146  Peroxisome
Module
sko_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100367300
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100367300
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     100367300
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     100367300
    4.2.1.119  enoyl-CoA hydratase 2
     100367300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 SCP2 KR Alkyl_sulf_C MaoC_dehydrat_N Tropomyosin Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 100367300
NCBI-ProteinID: XP_006812275
LinkDB All DBs
Position
Un
AA seq 1059 aa AA seqDB search
MSELRFDDRVVLVTGAGNGLGKEYALMFAERGASVVVNDLGGDIKGEGKSSRAADVVVNE
IRSKGGKAVANYDSVEDGEKVVKTALDNFGRIDVVVNNAGILRDRSFARTSDLDWDLIHR
VHLRGSFQVTRAAWPHMKKQKYGRIIMTSSGAGLYGNFGQANYSAAKLGLIGLANTLAIE
GEKYNIHTNTVVPMAGSRLTATVMPQYMIDALKPEYIAPLVVFMCHESCDENHTIFECGA
GWAAQVRLQRSKGAIYKKKNLAATPEQVRDSWNNITDFTDADIPTTIQESTGLAMQALSV
DENNERSIKPNNTSAVNVSQAIGHTQKSPNFTYGPDNIILYALGVGVSTKDEDYLKFLFE
GSDEFCVLPTFAVIPAFAAMTGGFTNVPGLDIDPTKILHGEQYLELHKPLATEGTLHSES
TVVDILDKGSGALIILNIKTFDEGNELVATTQFGSFVVGAGGFGGKRNSDKAMGQSIFDM
YPRPEISLELEPLCCLKEISYCSQNKINSFIQQHKLMVTEHTLMVTEHKLTVTEHKLMVT
EHILMVTEHKLMVTEHKFMVTEHKLTVTEHKLTVTEHKFMVTEHKFTVTEHKLMVTEHTL
MVTEHKLMVTEHTLMVTEDKFMVTEHTLMVTEHKFMVTEHKLMVTEHKFMVTEHELMVTE
HTLTVTEHKFMVTEHTLMVTEHKFMVTEHKLMVTEHKLTVIEHKLMVTEHKLTVTEHKST
VTEHKLTVTEHKLMVTEHKLTVTEHKLMVTEHKLTVIEHKLMVTEHKLMVTEHKLTVIEH
KLMVTEHKLTVTEHKSTVTEHKLMVTEHKLTVIEHKLTVTEHKLTVTEHKLMVTEHKLMV
TEHKLTVTEHKLMVTEHKLTVIAHKLTVIEHKLTVTEHKLMVRFAKTVLPGQTIKTEMWK
EGNRIHMQCKVGETGEVCLSGAYIDLIGTAAAGTSATSQVTSSSPIDMIFQEMGKRMNDF
PDLIKKVKGVYLYRMTDGKNPVAEYTVDLKTGNGEVYKGSPKQGKPDVTVTMAEQHFTDL
MTQKLNPQQAFFQGKLKVSGNVGLLMKAGQLFQKHAPKL
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagctcagattcgatgatcgcgttgttctcgtcactggagctggcaatggactg
ggtaaagaatatgctctgatgtttgctgaaagaggagcatcagttgttgtgaatgatcta
ggaggcgatatcaaaggtgaagggaagagtagtcgtgctgctgatgtggttgtaaatgaa
atcagatcaaagggaggcaaagctgtggcaaactatgattctgttgaagatggtgagaaa
gttgtgaagactgctttggataactttggaagaattgacgtggttgtcaataatgccggt
attctcagagaccgttcatttgcaagaacaagtgaccttgattgggatttgatccatagg
gtccatctgcgggggtcatttcaggtcacgagagcagcttggccacacatgaagaaacaa
aaatatggtagaattattatgacttcctctggggctggtttgtatggtaactttggtcag
gccaattacagcgcagcaaagctgggtcttattggattagccaacactcttgcaatagaa
ggtgaaaaatacaatatacataccaacaccgttgtgccgatggccggatcaaggttgact
gcaaccgtcatgcctcaatatatgattgatgcattgaagccagagtacatcgctccatta
gtagtgtttatgtgtcatgaaagctgtgatgaaaaccatacaatatttgaatgtggtgct
ggatgggcggcacaggtacgactccaacgaagcaaaggtgcaatttataaaaagaagaac
ttagcagcaaccccagagcaggttcgagacagttggaacaatatcactgacttcacagat
gctgacattccaactacaatccaagagagtactggcttagcaatgcaagctctatcggtg
gatgaaaacaatgaaagatccataaaacccaacaatacatcagctgtcaatgttagtcaa
gccattggacatacacagaagtcacccaactttacttatggacctgacaatattattcta
tatgcacttggagttggggtctcaaccaaagatgaggactatttgaaattcttatttgaa
ggcagtgatgaattctgtgtattgccaacatttgctgtgattcctgcatttgctgctatg
acaggtggatttaccaatgttcctggccttgatatagatcccaccaagattctccatgga
gaacagtatttggaactccataaaccattggccacagaaggaacgttgcattctgaatcc
accgtggttgatatattagacaagggatctggtgctttgattattctcaatattaaaaca
tttgatgaagggaatgaacttgtagcaaccacccagtttggcagctttgttgttggtgct
ggtggatttggtgggaagagaaattcagataaagccatgggtcaatctatttttgacatg
tacccaagacctgaaattagtctggagctagaaccactatgctgcttgaaagaaatttca
tattgctcacaaaataagatcaacagtttcattcagcaacataaattgatggttacagaa
catacattgatggttacagaacataaattgacggttacagaacataaattgatggttaca
gaacatatattgatggttacagaacataaattgatggttacagaacataaatttatggtt
acagaacataaattgacggttacagaacataaattgacggttacagaacataaatttatg
gttacagaacataaatttacggttacagaacataaattgatggttacagaacatacattg
atggttacagaacataaattgatggttacagaacatacattgatggttacagaagataaa
tttatggttacagaacatacattgatggttacagaacataaatttatggttacagaacat
aaattgatggttacagaacataaatttatggttacagaacatgaattgatggttacagaa
catacattgacggttacagaacataaatttatggttacagaacatacattgatggttaca
gaacataaatttatggttacagaacataaattgatggttacagaacataaattgacggtt
atagaacataaattgatggttacagaacataaattgacggttacagaacataaatcgacg
gttacagaacataaattgacggttacagaacataaattgatggttacagaacataaattg
acggttacagaacataaattgatggttacagaacataaattgacggttatagaacataaa
ttgatggttacagaacataaattgatggttacagaacataaattgacggttatagaacat
aaattgatggttacagaacataaattgacggttacagaacataaatcgacggttacagaa
cataaattgatggttacagaacataaattgacggttatagaacataaattgacggttaca
gaacataaattgacggttacagaacataaattgatggttacagaacataaattgatggtt
acagaacataaattgacggttacagaacataaattgatggttacagaacataaattgacg
gttatagcacataaattgacggttatagaacataaattgacggttacagaacataaattg
atggtacgctttgctaagacggtgctacctggtcagactattaagacagagatgtggaaa
gaaggcaacagaattcatatgcagtgtaaggttggtgagactggtgaggtctgcttatct
ggtgcttacattgatttgattgggactgctgcagctggaacatctgctacctcacaggta
acaagtagtagtcctattgatatgatctttcaagaaatgggaaagcgtatgaatgatttt
ccagatttgatcaagaaagttaaaggagtgtatttatacaggatgactgatggaaagaat
ccagtggctgaatacactgttgatttgaagactggtaatggagaagtatataaaggatca
ccaaaacagggtaaacctgatgtcacggtaaccatggcagaacagcatttcacagatctg
atgacacaaaaacttaaccctcaacaggcattctttcaaggaaagctaaaagtatctggt
aatgtcgggttgctgatgaaagcaggacagctgttccagaaacatgctcctaagctataa

DBGET integrated database retrieval system