KEGG   Saccoglossus kowalevskii (acorn worm): 100367443Help
Entry
100367443         CDS       T04123                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00010  Glycolysis / Gluconeogenesis
sko00051  Fructose and mannose metabolism
sko00052  Galactose metabolism
sko00500  Starch and sucrose metabolism
sko00520  Amino sugar and nucleotide sugar metabolism
sko01100  Metabolic pathways
sko01200  Carbon metabolism
Module
sko_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sko_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100367443
   00051 Fructose and mannose metabolism
    100367443
   00052 Galactose metabolism
    100367443
   00500 Starch and sucrose metabolism
    100367443
   00520 Amino sugar and nucleotide sugar metabolism
    100367443
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100367443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    100367443
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100367443
Membrane trafficking [BR:sko04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100367443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100367443
NCBI-ProteinID: XP_002740521
LinkDB All DBs
Position
Un
AA seq 448 aa AA seqDB search
MGDNKLETILECMHLNKDQLKSVKDRLHIEMMKGLGKASHANARVKMYPTYVRSTPDGTE
RGDFLALDLGGSNFRVLYIKIGEKVEQFSEVYKLTKELMEGTGEKLFDYIAECLANFIGK
QGLKDRALPLGFTFSFPCQQKGLASATLTMWTKGFKASGVEGKDVCVLLYEAVKRRGDIL
LDVIAVVNDTTGTLMSCAHAFPDCVVGLILGTGTNACYIEKLENVETWDGDTDPPKQVLI
NMEWGAFGDDGVLDDLRTEYDESIDKKTHNVGKQKFEKMISGMYLGELVRQILVKLAENH
VLFDGKTTEALRNSWKFETANLSQIEGDTSPDYKVCRKLMKDHGLEITDQGCKIVKAVCA
AVSSRAAQLAAAGIAAVACQVGKSDVTCGVDGSLYRKHPRFHDIMTATIKQLAPGVNVKF
VLSEDGSGKGAALVAAVAHTLKSKTKAE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaacaaacttgagactatactggagtgtatgcatctgaataaagatcaattg
aaaagtgtcaaagatagactacatatagagatgatgaaaggtcttggtaaagctagtcat
gctaatgctagagttaagatgtatccaacatatgtgagatctactcccgatggtacagag
agaggtgattttctcgccctggatcttggtggcagtaacttccgtgtgttgtacattaag
attggtgaaaaagtagaacaattcagtgaagtttacaagctaaccaaagagctgatggaa
ggcactggtgaaaagttatttgattacatcgcagagtgtcttgctaatttcattggaaaa
cagggattgaaggacagagcacttccacttggattcacattttcgtttccgtgtcaacaa
aaaggtttggcatcagccactctgacaatgtggactaaaggtttcaaagcctcaggagtg
gaaggtaaagacgtttgtgtacttctgtatgaagctgtcaaacgtagaggggatatttta
cttgatgtgattgcagtggtcaatgatacaactggaacactcatgtcttgtgcgcatgca
tttcctgattgtgttgtaggtctcatacttggaactggtaccaatgcatgctatattgaa
aaacttgagaatgttgaaacctgggatggtgacactgatccccctaagcaagtgttaatt
aacatggaatggggtgcatttggtgatgatggagtacttgatgacttgagaacagagtat
gacgagtcaattgataagaaaacacacaatgtgggaaaacaaaaatttgaaaagatgatt
tctgggatgtatcttggtgaattagttcgtcaaattcttgtgaaattagctgaaaaccat
gttttatttgatggtaaaacaactgaggcgttaaggaattcatggaagtttgagacagct
aatctttcacagattgagggagatacaagtccagattataaagtatgcagaaaactcatg
aaggatcatggtcttgagataactgaccaaggttgtaaaatcgtgaaagctgtgtgtgct
gcagtgtcatctcgtgctgcacagctagccgcagctggtattgctgctgttgcctgccag
gtcggaaaaagtgatgtcacatgcggggtggatggatctctgtacagaaagcaccccagg
ttccacgacatcatgacagccacaatcaaacagttggctcctggtgttaatgtcaaattt
gttctttcggaagatggcagtggcaaaggagcagcattagtagcggctgtcgctcataca
ctaaagagcaagacaaaagcagaatag

DBGET integrated database retrieval system