KEGG   Saccoglossus kowalevskii (acorn worm): 100368622Help
Entry
100368622         CDS       T04123                                 

Definition
(RefSeq) thymidine kinase, cytosolic-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00240  Pyrimidine metabolism
sko00983  Drug metabolism - other enzymes
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100368622
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100368622
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100368622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK ATPase_2 AAA_14 Herpes_ori_bp RecA
Motif
Other DBs
NCBI-GeneID: 100368622
NCBI-ProteinID: XP_002733254
LinkDB All DBs
Position
Un
AA seq 248 aa AA seqDB search
MMSCITTSDVICSSKKGQIQVIFGPMFSGKTTELIRRIKRFQIANHSCLIVKYANDDRYD
KNGIATHDREVKAAVSATELCPLRKTAMKYDVIGIDEGQFFPDCVEFSEEMASKGKKVIV
AALDGTFQRKGFGNILNLVPLAESVIKLNAVCMHCYSEASYTKRLGVETAVEIIGGTDKY
MAVCRACYVLPASHHHDFKDETPLRNLQLNDNKSNTTITTTNTLSMGRKLFKDSPKKNRE
NRPIEGTA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatgcataacgacttcagatgtgatatgttcgtccaaaaagggacaaatacag
gttatatttggaccaatgttttcaggtaaaacgactgaattaatccgaagaataaaacgt
tttcaaattgcaaatcatagttgccttattgtaaagtatgcaaatgatgatagatacgat
aagaatggaatagcgacacatgatagggaagtgaaagcagcagtgtctgcaacagagcta
tgtccactgaggaaaactgccatgaaatatgatgttataggaattgacgaaggacagttt
tttcctgactgtgtagaatttagtgaagaaatggcaagtaagggtaaaaaagtgattgta
gcggcgttagatggcacattccagagaaagggttttggtaatattttgaatctagtgcca
ctagcagagagtgtaattaaattgaacgcagtgtgtatgcattgttatagtgaagcgtcg
tataccaagcgactaggtgtggaaacggctgttgaaatcatcggtggcaccgataaatat
atggcagtatgtagagcctgttacgtactacccgcatcacatcatcatgattttaaagac
gaaacgccgctcagaaatctgcagctcaacgacaataaatcaaataccaccatcactacc
accaacacacttagtatgggtagaaagctttttaaagactctccaaagaaaaatagagaa
aatcggccaattgagggaactgcttga

DBGET integrated database retrieval system