KEGG   Saccoglossus kowalevskii (acorn worm): 100369495Help
Entry
100369495         CDS       T04123                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sko01002]
    100369495
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    100369495
   04090 CD molecules [BR:sko04090]
    100369495
Enzymes [BR:sko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100369495
Peptidases [BR:sko01002]
 Metallo Peptidases
  Family M2
   100369495
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100369495
CD molecules [BR:sko04090]
 Proteins
  100369495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100369495
NCBI-ProteinID: XP_002741143
LinkDB All DBs
Position
Un
AA seq 1415 aa AA seqDB search
MRYLLLFSAALVAVRAQIDCGAPAGSVADESKAVLWLNNTYNPNAEIIYSTAISASWDYE
TNITEYNQQVMLDAISVAGGFDRDMRTCALVFDRTDFTFDTNRRLENLIYIGAAALDDEK
FDEFNQIVADMSAIYNTGEVCDKPGDPNPDACYPLDPDLYDVMANSRNWSELVWAWEGWR
DTCGPPMKPMYPRYVELSNEAALLNDQPDMGAFWRSWYEMEDFEAEVMRLWDEVLPMYEQ
LHAYVRRKLSGVYGTEHVSLTGAIPAHITGNMWAQDWMSISDIVLPFPNASSIDVTDELI
NQGYDALQMFQLSEDFFVSMGLIPSPQSFWEDSMFEKPDDGREVTCHASAWDFFNRKDFR
IKMCTRVNHEDLITIHHEMGHTQYYYQYAPQPVEYRDGANNGFHEALGDTISLSVQTPEH
LYEVGLLPELVQDQESDLNYLMSMALQKVAFLPFGLLIDLWRWEIFDGTITEYNYNERWW
HMRTGIQGVVEPVKRSDLAGDFDAGAKYHVPADVPYIRYFVSHILQFQFHEAICEAAGEY
PAKPLHHCDVYESHEAGDLLAEMMRPGSSIPWQDVLEAMTGSRDMSTLPLQEFFKPLITY
LTAENTKNDEFIGWDINWKPPETPCKHHSTAAMYAVMNAAAIVLACLSMSALISAEDELI
TDEGEAREYLVMYNTLAQETYFKYVTTSWNYATNLTDVNKDIFVQESLKSAAFDLEARAN
VSKFDWTNFDPDVMRQLQKIYYIGSSALEGDDLIEYENILADMEQIYSTAKVCESESICI
PLDPDLTRLMATSRDYDELKWAWEGWRRETGPEMKDMYENFVTLANKAAKVNDQPDMGAY
WRSWYEVDDLKADSMRLWEQLRPFYEQLHAYVRGRLSEHYGESLVDPKRPIPAHLLGNMW
AQSWGNILDLVLPYPGKTSIDVTPALVDQGYDALRMFNISEEFFTSLGLIPSPQSFWDDT
MFVKPTDGRDVVCHASAWDFYNAKDIRIKMCTSINMEDLITIHHEMGHTQYFLQYKDQPV
VYRRGANPGFHEAVGDLLALSVSTPDHLHQIGLLDTVEDDAEADINFLMSMALDKIAFLP
FGLLMDLWRWDVFEGLTTKDSYTEAWWKLRNDIQGVEAPVERSDEAGHFDPGAKYHIPGN
TPYIRYFISHVLQFQMHRSLCETAGNTRSLHQCDIYRSKEAGKKLGDMLKLGSSKKWPEA
LEAITGSREMDASAIVDYFKPLMTWLEEKNEEKGYVVGWSDTGSVITMNDINEEYVSLLN
EMMWIQVLAIIKKHLKSIICENIEDATFVKSHRAYESEKIGSSYDKVVNIEKRIACGVAE
RMKTTDNTDFLENTADGQNTLHGTMLVISQNEEMARELYEAGKEFTPPYSGEWELHLGAL
EVQVKYYFAHDLHKYARLVSVYFAQMKLLKKPGML
NT seq 4248 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctactgcttttcagcgcagccctggtcgctgtgcgtgcgcaaatagactgc
ggtgcacccgctgggtcggttgcagacgaatctaaggccgtgctctggttgaataatacg
tacaaccccaatgcagagatcatttactcaaccgccattagtgcgtcttgggactatgag
actaacatcaccgagtacaaccaacaagtgatgttagatgctatatccgtcgctggtggt
tttgacagggacatgcgaacgtgtgctttggtattcgacagaactgatttcacatttgat
acaaacagacgattagagaacctcatctatatcggtgcagcggcgctggatgatgaaaag
ttcgatgagtttaaccaaatagttgctgacatgtcggctatttacaacactggtgaggta
tgtgacaaaccaggggatccaaatccagatgcatgttacccattggacccagatctgtat
gacgtaatggccaatagtcgcaactggagtgaactggtatgggcatgggaaggatggcgt
gatacatgtggtcctcccatgaaaccaatgtacccgagatatgttgaattatccaacgaa
gcagctcttctgaacgaccaaccggacatgggtgccttctggcgatcctggtatgaaatg
gaagatttcgaggctgaagtaatgagactgtgggacgaagtgttgcctatgtacgagcag
ttacatgcatacgtacgaagaaagttgagcggggtttatggaacagaacacgttagttta
accggagccatcccggcacacatcaccggtaatatgtgggcacaggattggatgagtatc
agcgacatcgtgttaccattccctaatgcttcatccattgatgttacagacgaattaatt
aaccagggttacgatgctctgcagatgttccaactatcagaagatttctttgtatccatg
ggattgattccatcgccacagagtttctgggaggattccatgtttgaaaaaccagatgat
ggacgagaggtcacgtgccatgcttcagcgtgggattttttcaacaggaaagatttcaga
atcaagatgtgtacacgtgtaaatcacgaggatttgatcaccattcatcacgagatggga
cacactcagtattactaccaatacgcaccacagcccgttgaataccgcgatggcgccaac
aatggcttccacgaggcgctcggtgacaccatatctctgtctgtccagacaccggaacat
ctctacgaggttggtttactaccggaacttgtccaagatcaggagtcggatctgaattac
ctgatgtcgatggctttgcagaaagtagctttcctgcctttcggtttactcattgacctc
tggagatgggaaatctttgacggcaccattactgaatacaactataatgaaaggtggtgg
catatgagaactggtattcagggtgtggtggagccagtcaaacgttccgatttggcgggt
gattttgatgctggcgcaaaataccacgttccggccgacgttccctacatcaggtacttc
gtgagtcacattttgcaatttcagttccacgaagccatatgcgaggctgctggcgagtac
cctgctaaaccactgcaccattgcgacgtgtacgagtctcacgaagctggtgatcttctc
gcggaaatgatgaggcctggttccagtataccttggcaggacgtcctagaagcaatgacc
ggatcacgtgacatgagtacgctcccgttacaggaattcttcaaacctttgataacttat
ctgactgccgagaacactaagaacgacgagttcattggctgggatattaactggaagcca
ccggagaccccttgcaaacaccactctaccgccgctatgtacgccgtgatgaatgctgct
gccattgtcttggcatgtctctcaatgtccgcgctaatctccgctgaagacgagttgata
acagatgaaggcgaagccagagagtatcttgttatgtacaatacccttgcgcaagaaacg
tatttcaaatatgttactacgtcctggaactacgccacgaacttgacagatgtgaacaag
gatatattcgttcaagaaagtctgaaatccgcagcatttgatttagaggcccgtgccaac
gtgtcaaagttcgactggactaattttgacccggatgtgatgaggcagcttcagaagatc
tactacatcggatcgtctgcattggaaggggacgatttgatagaatatgaaaacatccta
gctgatatggagcagatatactcaacagcgaaagtgtgcgaaagtgaatcaatttgcata
cccctggatccagatctcacgagactaatggcaaccagtcgtgactatgatgagttgaaa
tgggcatgggaaggttggcgtagagaaactggacctgaaatgaaagatatgtacgagaat
tttgtgactctggcgaataaagcagcaaaggttaatgatcaacccgacatgggagcctac
tggcggtcttggtacgaagtagatgacttgaaagccgactctatgcgtctctgggaacaa
cttaggccattttatgagcagctgcacgcatacgtcagggggagacttagtgaacattat
ggggagtcgttggttgatcccaaacgtcccatacctgcacatttattaggtaatatgtgg
gctcagagttggggtaatatactggatctggttctaccttaccctggaaagacttcaatt
gatgtcacgcctgctctggtggatcagggttatgacgcactgcgcatgttcaatatatcc
gaggagttcttcacatctcttggtttgatcccttcgcctcaatccttctgggatgacacc
atgttcgtgaaaccgacggatggtagagatgtggtctgccatgcatcggcctgggatttc
tacaacgcaaaagatataagaatcaaaatgtgcacatcaatcaatatggaagatctgata
accattcaccatgaaatgggacatacacaatatttcctgcaatataaagatcaaccggtc
gtgtatcgcagaggagccaacccaggattccatgaagctgttggtgacttacttgctctg
tccgtatccacacccgatcacttacatcaaattggtttattagatacggttgaagatgat
gccgaggccgacatcaactttctgatgagtatggcgttggataagatagctttcttgccg
tttggtttgttaatggatctctggaggtgggacgtgtttgaaggcctcacgaccaaggac
tcgtacacggaggcgtggtggaagctaaggaacgacattcagggagttgaggcacctgtt
gaacgaagtgacgaagctggccattttgacccaggcgccaagtaccatatacctggcaac
acgccatatatacgatacttcattagtcatgtgttgcagtttcaaatgcatcgttctttg
tgcgaaacagctggtaatacccgttccttacaccagtgtgacatttacagatctaaggaa
gctggcaaaaaattaggggatatgttaaagcttggttcaagtaaaaaatggcctgaggca
ctggaagctataacaggaagcagggagatggacgcctcggccatagttgattacttcaaa
ccgctgatgacttggttagaagagaagaacgaggaaaagggatatgttgtgggatggagt
gacacaggctctgttataacaatgaatgatatcaatgaagaatatgtttccttactgaat
gaaatgatgtggatccaggttctagccatcataaaaaaacatctaaaaagtatcatatgt
gaaaacattgaagatgctacatttgttaaatcacatcgggcatacgaaagtgagaaaatt
gggtctagttatgacaaggttgtcaacatagaaaagcgtattgcttgtggagttgctgaa
cgaatgaagacaactgataatactgattttctagagaacactgcagatggtcagaacact
cttcatggtacaatgctggtaatcagtcaaaacgaggagatggcacgagagttatatgaa
gccggtaaagagtttacaccaccttattcgggagagtgggagcttcatcttggtgctctt
gaagtgcaagtcaagtactactttgctcatgatctccacaagtatgcccgacttgtgtca
gtatattttgcacaaatgaagctgcttaagaaacctggaatgctctga

DBGET integrated database retrieval system