KEGG   Saccoglossus kowalevskii (acorn worm): 100370203Help
Entry
100370203         CDS       T04123                                 

Definition
(RefSeq) DNA ligase 3-like
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko03410  Base excision repair
Module
sko_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:sko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    100370203
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sko03400]
    100370203
Enzymes [BR:sko01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100370203
DNA repair and recombination proteins [BR:sko03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100370203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 zf-CCHH RNA_ligase mRNA_cap_enzyme BRCT
Motif
Other DBs
NCBI-GeneID: 100370203
NCBI-ProteinID: XP_006814900
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MAENRYSCDYARLGTSKCKKCKQKIDKKEARIAKLVSNPFSEDGGDMKQYFHIGCMFETF
QRARATTKKIEDPSDLEGFQDMEDEEKATIRKHINELQAKLSTPKKTPTKKKAAQATLTT
AGQVVSPTKKTPIKTPQKIDYEDIKPIVSSKSDDPMTQRDNSFRQFRRVCADIAEEPSYN
AKTQLVSNYLKKGNSGDGFKGDVYLLMKLLLPGSVKRVYNINNKQLIKLFSQIFGASQDD
MLTDLEQGDVSETVKKFFEEESSLPPAKKSILSLQEVDNFLDRMTFLTKEDEQQQELTRI
AKQCTGNDLKTIIRLLKHDLRMNAGAKHILEALDPNAYEAFQASRNLKDVVERVQENIKA
SNGVPSMKKKLSVRASLMTPVLPMLAEACKSVDYAFKKCQNGMYAEIKYDGERVQVHKEG
DDFQYYSRSLKQVLPHKVAHFKEFLPKACPHGNSLILDAEVLLVDTNTGIPLPFGTLGVH
KKAAFQDASVCLFVFDCLHFNGENLMDKPIMERKKILRENMTEIPNKIMFSEAHLINKPI
DLKDLIMKTIREGLEGLVLKDLMGLYEPGKRHWLKVKKDYLAEGAMADTADLVVLGGYIG
TGSKGGMMSVFLMGVHDPHSDQWVTVTKCGSGFDDKKLDQINKALDVNKISQEVSKVPSW
LKINKSVVPDYIVKDPKNSPIWEITGAEFTQTKTHTADGISIRFPRCTKVRDDKSXKEAT
NLPRLKVLYKKSKEHSDIPDMIGGSSKRKIDSDSEASTSKSPLKVTPTSTSVKMSPAKKL
KNNSSDGSDSNLMKPVCKYGADCYQKNPKHMAAFDHSPKKGFSAASSPVKAPPAITPLVK
HLPEVFTGMQIYLPKTTPKFDKLKRYIIAFDGDVVADYEKDTATHIAVDDVKKALNGNKF
VTTKWLWECIKNKKLVPK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaccgatacagctgtgactatgcacgactcggaacttccaaatgtaagaaa
tgcaagcagaagatagataagaaagaagcgcgtattgcaaagcttgtctcgaatcctttc
tctgaagatggtggtgatatgaagcagtactttcatattggatgtatgtttgagacgttc
cagcgtgccagagcaacgacaaagaaaatagaagatccgagtgatttggagggatttcaa
gacatggaagatgaggagaaggctaccattaggaagcatattaatgagttgcaggccaag
ctatcaactccaaagaagacaccaacaaaaaagaaagctgcacaagcaaccttgacaact
gcaggccaagtagtgtctccaacgaagaaaacaccaatcaaaacacctcagaaaatagat
tatgaagatatcaaaccaatagtatcttcaaagtcagatgacccaatgacacagcgtgac
aactcatttcgccagtttcgtagagtgtgtgccgatattgctgaagaaccaagctataat
gctaaaactcaactcgtatccaactacctcaagaaggggaactcaggagatggtttcaaa
ggagatgtttatttattaatgaaattattactaccgggaagtgttaaaagagtgtataac
atcaataataaacagcttattaagctgttcagtcagatttttggagccagccaggatgac
atgttgactgatttggaacagggtgatgtctctgaaactgtcaagaaattttttgaggaa
gaatcatctttgcctccagcgaaaaaaagtattttgtctttgcaagaggtggataatttt
cttgatagaatgacttttttgaccaaagaagatgaacagcaacaagaattaacgagaatc
gctaaacagtgtacaggcaacgaccttaaaacaattattagactactcaagcatgatctt
cgaatgaatgctggagccaaacatatactggaagcacttgatccaaatgcatatgaagca
tttcaagcatccaggaacttaaaagacgttgtggagagagtacaagaaaatatcaaagca
agtaatggagtgcctagtatgaaaaagaaactcagtgtgagggcgtctttgatgacccct
gtcttgcccatgctggctgaagcatgcaaatcagttgattatgcattcaaaaaatgtcag
aatggaatgtacgccgaaataaagtatgacggggaaagagttcaggtccataaagaagga
gacgatttccagtattatagtcgaagtttgaaacaagtcctcccacacaaggttgcacac
tttaaggaatttctaccaaaggcatgtccccatggtaacagtttaattttagatgctgag
gttttactagtggatactaacactggaatacctctgccatttggaaccttgggtgttcac
aagaaagcagcatttcaagacgctagtgtgtgtttgtttgtatttgattgcttacatttt
aacggagaaaacttgatggataaaccaatcatggaacgcaagaagatactaagagaaaat
atgacagagatcccaaataaaataatgttttcagaagcccacctcataaataaacccatt
gacttaaaagacttaataatgaaaactataagagaaggcttagaaggattagttcttaaa
gacctgatgggtctttatgaaccaggaaaaaggcattggttgaaggtgaaaaaggattac
ttagctgagggggccatggctgatactgcagatttagttgtactagggggttacattgga
actggtagcaaaggtggtatgatgtctgtgttcctaatgggtgtacacgatccacactct
gatcagtgggttactgtgactaaatgcgggagtggatttgacgataagaaattagatcag
atcaacaaggcattggatgtcaataaaatcagccaagaagtcagcaaagtaccaagttgg
ttgaaaattaataagtctgtggttccagattatattgtcaaagatcccaagaattcacca
atatgggagataactggagctgaatttactcaaacaaaaacacatactgcagacggtatc
tctattcgttttcctcgatgtaccaaagtgagagatgacaaatctntgaaagaagcaaca
aacttaccaagactcaaggttctgtacaagaaatccaaagagcactctgacatacctgat
atgattggtggatcctcaaaacgaaaaattgattcagattccgaggccagtacatctaaa
agtccattgaaagttaccccaacatcaacttcagtcaaaatgtctccagccaaaaaacta
aaaaacaatagtagcgatggaagtgattcaaatcttatgaaacctgtgtgtaaatatggt
gcagactgttaccagaaaaatcctaaacatatggctgcttttgatcactcaccaaagaaa
ggattctctgctgcatcatcaccagtcaaagcaccaccagcaatcacgccattagttaag
catttaccagaggtgtttactggtatgcagatttatttaccaaaaactactcccaagttt
gacaagttaaaacgctacattattgcatttgatggtgatgttgtcgctgattatgaaaaa
gacaccgctacccatattgctgttgatgacgtcaaaaaggctttaaatggtaataaattc
gtgacaacaaagtggttatgggaatgtattaaaaataaaaagttggtgccaaagtaa

DBGET integrated database retrieval system