KEGG   Saccoglossus kowalevskii (acorn worm): 100370381Help
Entry
100370381         CDS       T04123                                 

Definition
(RefSeq) serine/threonine-protein kinase B-raf-like
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04068  FoxO signaling pathway
sko04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:sko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100370381
   04150 mTOR signaling pathway
    100370381
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100370381
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100370381
Protein kinases [BR:sko01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100370381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Pkinase_fungal Kinase-like zf-RING-like C1_2 APH Kdo DUF1258
Motif
Other DBs
NCBI-GeneID: 100370381
NCBI-ProteinID: XP_006821654
LinkDB All DBs
Position
Un
AA seq 733 aa AA seqDB search
MTELKSSIMKNPSMYLQEYEELTEKLDNLQLTEQSLLDRMSNGRASPSPQPSPNIMPNIL
PTMILPQSARPTNPQPKSPHANLTRVCLPNQQRTTVVAVEGRTLRDSLSKAMQRRGYSSE
TCLVFRKDTGGPVDWDTDMSWLEGEELLVQVNEHFRATSSILHNFVRKTFFTLAFCDSCR
RLLFHGFKCQTCGYKFHQRCAQDTPPLCVSGNFYKMLLGLKGTGAEMPSDSRSVFLDSDT
EQNDPGYGKGMTLPLGATSSPQHIPKPGLPRERSTSAPSINLVTGDHDSKTLEELQLLSR
HHRAAQSSAGPDYSARQLQNSPCKTRQTPTPSKDSVFDYSPASILRGNNLSTSFTSSGYS
SMVGCASLPNSTSSPTRIAVSSPTTGHHSKPRTPSSSTEVRRRTRHRRDSNDDWEIPADE
IVIGPRIGSGSFGTVYRGQWHGAVAVKKLNVTDPTPSQLQAFKNEVAVLRKTRHANILLF
MGCTSKPELAIVTQWCEGSSLYKHLHVKEVKFEMREVIDVGRQTAQGMDYLHAKNIIHRD
LKSNNIFLHDDMTVKIGDFGLATVKSRWSGSERMEQPTGSILWMAPEVIRMQDRNPYTPQ
SDVYAFGICLYELATGQLPYSNINNKDQIIFMVGRGYLSVNPEDARSDTPKAFKRLMADC
CKKNRDDRPLFPQVLASLEHLARSLPKLHRSASEPVSLNRTRLQSEDFLYYCPSPKTPLQ
SQFPAFGFGYPNL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattgaaatcttcaataatgaaaaatccgtccatgtatttgcaggaatatgaa
gaattgacagaaaaactggataacttacaactgactgaacaatcccttctggacagaatg
agcaatggaagagcatcgccatcaccacaaccgtctccaaatatcatgccaaacatatta
ccaacgatgattctaccacaatctgcaagaccaacaaacccacaacctaaatcaccccat
gccaaccttacaagggtttgtctaccaaatcaacaaagaactacagttgttgctgttgaa
ggacgtactcttcgtgactctttatcgaaagcgatgcagaggagaggttactcatctgag
acgtgtctggttttcaggaaagatacaggagggcctgtagattgggatacagacatgtca
tggttagaaggagaagaacttttagtacaagtcaatgaacacttccgagcaacaagtagt
atattacataattttgttcggaaaacatttttcacattagcattttgtgatagttgtcgt
cgacttctatttcatggatttaaatgtcagacatgtggctataagttccatcaacgctgt
gcccaagatactccccctctttgcgtatcaggcaatttttataaaatgttgctagggcta
aaaggaactggtgctgagatgccatcagattcacgtagcgtgtttctagattctgataca
gaacagaatgatccaggttatggcaagggaatgacactaccactaggagccacatcgtca
ccacagcatatacccaaacctggtctaccgagagaacggtctacctcagctccaagtatt
aatttagtcacaggggatcatgacagtaaaactcttgaggaactacaattattatcaaga
catcacagagctgctcagtcgtctgctggtccagactactcagccaggcagctgcaaaac
agtccctgtaaaacacgtcaaacaccgactccttccaaggacagcgtatttgattatagt
ccagctagcatattgaggggtaataatctatcaacaagttttacatcatcaggctattct
tccatggtgggatgtgcatcattaccaaattcaacctctagtcctaccagaatagcagta
tccagtccaactactggacatcactcaaagccaagaacaccttcatcctcaacagaagta
cgcagaagaactagacataggcgagattccaacgatgactgggaaattccagcggatgaa
atagttatcggtcctaggattggatctgggtcatttggaacagtatacagaggacagtgg
catggtgctgtagcagtcaaaaagttgaatgtaacagacccaactccgtcacagttacaa
gcgttcaagaatgaagtagctgttcttaggaaaacgagacatgccaatattttattattt
atgggatgtacgtctaaacctgagttagcaattgtaacacaatggtgtgaaggatctagt
ctttataaacatctccatgtcaaggaagtcaagtttgaaatgcgtgaggtcattgatgtg
ggcagacagactgcacaagggatggactatctccatgccaagaatattatacacagagac
ttgaaatcaaacaatatatttttacatgacgatatgacagttaaaattggtgattttgga
ctagctactgtgaaatcaaggtggagtgggtctgagagaatggaacaacctacaggatcc
atcctatggatggcaccggaagttattcgtatgcaggatagaaacccatatactccacag
tcagacgtttacgcattcggtatttgtctgtatgagctcgctaccggtcaattaccatat
tcaaatatcaataataaagatcagataatattcatggttggtaggggttacctttctgta
aatccagaagatgcacgaagtgatactcctaaagcattcaaaagattaatggctgattgc
tgtaaaaagaatcgtgacgatagaccattgtttccacaggtccttgcatctttagaacat
ttagcaagatcattacccaagcttcatcgcagtgcatcagaaccggtatcattaaatagg
actcgtctacaatctgaagattttctttattactgtccctctccaaagacacctctacag
agtcaattccctgcatttggctttggttatcccaatctatag

DBGET integrated database retrieval system