KEGG   Saccoglossus kowalevskii (acorn worm): 100370704Help
Entry
100370704         CDS       T04123                                 

Definition
(RefSeq) transketolase-like
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00030  Pentose phosphate pathway
sko01100  Metabolic pathways
sko01200  Carbon metabolism
sko01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100370704
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    100370704
Enzymes [BR:sko01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     100370704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr Transketolase_C Transketolase_N YjeF_N
Motif
Other DBs
NCBI-GeneID: 100370704
NCBI-ProteinID: XP_002733574
LinkDB All DBs
Position
Un
AA seq 543 aa AA seqDB search
MAEYHRPDSKKIQNLRDVANRLRIHSISATNASNSGHPTSCCSAAEIMSVLFFHQMKYKV
KEPKDAANDRFVMSKGHAAPILYAAWAEAGLFPKEDLLNLRKIDSDLEGHPTPRLNFIDV
ATGSLGQGLSIACGMAYIGKYIDKARTKLRLFTPRLLFKRLYGILLFASNEGIEDQMNWH
GKPLGDKAEGAIEAIHKLIVTKNGHGLCPQLPSSEVPAVDLKVKLSEPPSYTKGQKVATR
LAYGTALAKIGTDNVRVVAMDGDTKNSTFADKFKNAHPDRFVECFIAEQNLVGVAIGAAC
RDRTVAFASTFAAFFSRAYDLLRMGAISQTNANFCGSHCGVSIGEDGPSQMALEDLAMFR
AIPGSTVFYPSDAVSTERAVELAANTTGICFIRSSRPPTAVLYDNNEVFQPGKAKVVRQS
DKDSVTIIGAGVTLYEAIAAADKLSADGINVRIIDPFTIKPLDVETIATNARKTGGKILT
VEDHYPEGGIGEAVAGAMSEFPNITIRRLAVNAVPRSGKSTELLDMFGISSSAIVKTIKE
MVK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatatcatagacctgacagcaagaaaatacaaaatttaagagatgttgcgaac
cgtctacgaattcacagcataagtgctacgaatgctagcaattctgggcatccaacatca
tgttgcagtgcggcagagattatgtctgtattgttcttccatcaaatgaagtataaagta
aaggaaccaaaagatgcagcaaacgacagatttgtcatgtctaagggccatgcagctcct
attctgtatgcagcttgggcagaggctggtttatttccaaaagaagatttgttaaatcta
agaaagattgacagtgatttggaaggacatccaacacctagacttaatttcatagatgta
gccactggttccttgggacaaggtttgagtatagcatgtggtatggcatatattggaaaa
tacattgataaagcaagaaccaaattgagacttttcactcctcgacttctatttaaaaga
ttatacggtatcttgctttttgctagcaacgaaggtattgaagatcaaatgaactggcat
ggtaaacctcttggtgataaagctgaaggtgcaattgaagctattcacaaattgattgtc
actaagaatgggcatggtttgtgtccacagctcccctctagtgaagtgccagctgtggat
ttaaaagtcaaactatctgaaccacctagttatactaaaggacaaaaggtagctactcgt
ttggcttatgggactgcattggctaaaataggaactgacaatgttagagtggtagcgatg
gatggagatacaaagaactcaacatttgctgataaattcaagaatgcccatccagatcgt
ttcgttgaatgtttcattgctgagcaaaatcttgttggtgtggccattggtgctgcttgt
cgtgaccgtactgttgcgtttgctagtacatttgctgcattcttcagtcgtgcatatgat
ctgcttcgtatgggagcaatttctcaaacaaacgcaaatttctgtggatctcattgtggt
gtttctataggtgaggatggaccttcccagatggcattggaagatttagctatgttccgt
gccattcctggctctactgttttctatcccagtgatgcagtgtccactgaaagagctgtt
gagttagcagccaacaccaccggaatctgctttattcgtagcagccgtccacctacggct
gtgctatatgacaacaatgaagttttccagcctggtaaagcaaaggttgtacgtcaaagt
gacaaagattctgtgactattattggtgcaggtgtcacattatatgaagcaatagctgct
gccgacaagctatccgctgatggcattaatgtgcgaatcatcgatccatttaccattaaa
ccattggatgtagaaactattgccacaaatgctcgcaagactggtggtaaaattctcact
gttgaagatcattatcctgaaggtggcataggtgaggctgttgcaggcgctatgtcagag
tttcctaatatcaccatacgtcgcctagcagtgaatgctgtaccacgtagtggaaaatct
accgagctgctcgatatgtttggtatcagttcttctgctatcgtcaagaccattaaggaa
atggtgaaataa

DBGET integrated database retrieval system