KEGG   Saccoglossus kowalevskii (acorn worm): 100371134Help
Entry
100371134         CDS       T04123                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00020  Citrate cycle (TCA cycle)
sko00190  Oxidative phosphorylation
sko01100  Metabolic pathways
sko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100371134
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100371134
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100371134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 100371134
NCBI-ProteinID: XP_002741304
LinkDB All DBs
Position
Un
AA seq 666 aa AA seqDB search
MAACLKLQTNLLRRLSAEKLTSSISQTAIRPATSRGFHFTVQGKQTDAAAKRDQISRDYP
VVDHTFDAIVVGAGGAGLRAAFGLAIDGFKTACLSKLFPTRSHTVAAQGGVNAALGNMEP
DEWRWHMFDTVKGSDWLGDQNAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQ
SYDYGRGGQAHRCCCVADRTGHSLLHTLYGQSLHYDVHYFIEYFAMDLIMDGDECRGVTA
LCLEDGSIHRFRAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMTSKAGIANSDMEFVQFH
PTGIYGAGCLMTEGCRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRG
VGPEKDHVYLQLHHLPPEQLHSRLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGVPTN
YTGQAIGHRNGEDFIIGGLYACGESACASVHGANRLGANSLLDLVVFGRACAHTISENNK
PGDPIPEFKKNAGEESVANLDKFRHANGSTPSSVLRLKMQKTMQNNAAVFRTGETLKEGC
KLIDEVYDGLEDIKLYDRGMVWNTDLVEALELQNCLINAVQTMHAAENRKESRGAHARED
FKDRIDEYDYTKPLEGQKKKALKDHWRKHSLSYVDNGKVTLDYRPVIDETLDQEECAWVP
PRIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtgtctgaagctgcaaacgaatttgctccggagactttctgcggaaaagctg
accagcagcatcagccaaacagcaataagaccggcaacatcaagaggtttccattttact
gtgcagggcaaacaaacagatgccgctgctaaaagagaccaaatttcccgcgattatcca
gttgtagaccacacatttgatgctattgtggttggagctggaggtgctggattgagagcc
gctttcggtttggcaattgatggttttaaaacagcatgtctttcaaaattattcccaaca
aggtcacacactgtagcagcgcagggtggcgtaaatgcagcgttaggaaacatggaacct
gatgagtggagatggcacatgtttgatacagtgaaaggttctgattggttaggagatcaa
aatgcaattcattatatgacacgagaagctccaaaagctgtaattgagttagaaaattat
ggtatgccattcagcaggacaccagatggtaaaatctaccagcgagcatttggtggacaa
agttatgattatggcagaggtggtcaagctcatagatgttgttgtgttgctgatcgtaca
gggcattcattacttcacacattatatggacaatctctacattatgatgtgcattacttt
attgaatattttgcaatggatcttataatggacggtgatgagtgccgtggtgttactgct
ttatgcttggaagatggtagcatacacagatttagagccaaaaatacagtacttgctaca
ggtggttatggacgtgcatatttcagctgtacatctgctcatacatgtactggtgatggt
acggctatgacatctaaagctggaatcgctaacagcgacatggaatttgtgcagttccat
ccaacaggtatttatggtgctggttgcttgatgactgaaggatgtcgtggtgaaggtggt
tatttgataaacagtgaaggagaacgatttatggagcgttatgccccaacagcaaaagac
ttagcatctcgtgatgttgtttcccgctcaatgactatggaaattcgtgaaggaagggga
gttggtccagaaaaagaccatgtctaccttcaacttcatcacttgccaccagaacagtta
cacagtcgtcttccaggtatatctgagactgctatgatatttgctggtgttgatgttaca
agagaaccaattccagtaataccaactgtacattataacatgggtggagtgcccacaaac
tacacaggacaggctattggtcaccgtaatggagaagatttcataattggtggtctctat
gcttgtggtgaatcagcatgtgcttctgtacatggtgcaaaccgactcggagccaactct
cttctggatttggttgtatttggacgtgcttgtgctcatactatttccgagaacaacaaa
ccaggtgaccctatcccagaatttaaaaagaatgctggtgaagaatctgttgcaaatttg
gataaattcagacatgccaatggaagtaccccttcatctgtattgagacttaaaatgcaa
aagacaatgcaaaacaacgctgcagtgttcagaacaggtgaaactctaaaagaaggctgt
aaattgattgatgaggtctacgatgggttagaagacatcaaattatacgatagaggaatg
gtatggaacactgatctagtagaagcattggaactacagaattgtctaattaacgctgta
cagacaatgcatgctgctgagaaccgtaaagaaagtcgtggtgctcatgcacgtgaagac
ttcaaagaccgtattgatgaatatgactacaccaaacctttagaaggacagaagaaaaag
gccctgaaagaccattggagaaaacattcactatcctatgtggataacggaaaggtgact
cttgattaccgccctgtcattgatgaaacattggaccaagaagagtgtgcctgggtacca
ccaagaatcaggtcttactaa

DBGET integrated database retrieval system