KEGG   Saccoglossus kowalevskii (acorn worm): 100371403Help
Entry
100371403         CDS       T04123                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 12-like
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00062  Fatty acid elongation
sko01040  Biosynthesis of unsaturated fatty acids
sko01100  Metabolic pathways
sko01212  Fatty acid metabolism
Module
sko_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100371403
   01040 Biosynthesis of unsaturated fatty acids
    100371403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sko01004]
    100371403
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100371403
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     100371403
Lipid biosynthesis proteins [BR:sko01004]
 Fatty acid synthase
  Component type
   100371403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Shikimate_DH DUF1863 F420_oxidored NAD_binding_10 Sacchrp_dh_NADP Epimerase
Motif
Other DBs
NCBI-GeneID: 100371403
NCBI-ProteinID: XP_002733501
LinkDB All DBs
Position
Un
AA seq 318 aa AA seqDB search
MMEPIYNTILRVIGAVTVGYISFNLLSNILRSIKVYFLSGPLGLATDLRKLGQWAVVTGA
TDGIGKAYAKQLAAKGINIVLISRTLTKLQSVAMEIESEYKVKTKVIAVNFFQGVEIYQE
IKEGLDGLEIGTLVNNVGTSSLPDCFLDIPNLDKHIPEILNCNVLSCTMMTKLVLPQMVK
RSKGAVINIASVAGYQPNPFSVVYSSTKAYVDFFSRGLHEEYSSKGIFVQSVLTFFVATK
LSGIDKSETSFFVPLPEDFTKSALGTVGLQSRTHGYFSHALQVWLVNLLPRWYITHLTEK
MFMDMKNKALKEIAQKKE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcctatctataacacgatcctgagagttatcggggcggtcaccgtgggatat
atttcattcaatttgctatcgaatattctccgtagtatcaaggtctatttcctatccggt
ccgcttggattggccacagatctgagaaaacttggacagtgggcagttgtgacaggcgct
acagatggaattggtaaagcatacgcaaaacagctggctgctaagggtatcaatattgtt
ttaatcagcagaacattgaccaagttacagagtgttgccatggaaatagaatcagagtac
aaagtcaagacgaaggtgattgctgtgaatttttttcaaggagttgaaatatatcaggag
attaaagaaggattggatgggttggagatcggaacgttggttaataacgtaggaacaagc
agcttacccgattgtttcctagatatcccaaatttggataagcatattccagaaatactt
aactgtaacgtgttgtcatgcacaatgatgacaaaactagtattaccacagatggtaaaa
agaagtaaaggtgctgttataaacatagcgtcagtagcgggatatcagccgaatccattc
agtgtcgtatactcatcaacaaaggcctatgttgatttcttttcacgaggattacatgag
gagtattcatcaaagggaatatttgtgcagtctgtgttgacattctttgtcgcaacaaaa
ttaagtggaattgataaaagtgagaccagtttttttgttccactaccagaagactttact
aaaagtgcccttggtactgtcgggctgcagagccgaacacatggttatttctcacatgca
ttacaggtgtggctagtgaatctcttgccacgatggtacattacacacctcacagagaag
atgttcatggacatgaaaaataaagcattgaaggaaatagcccagaaaaaagaatga

DBGET integrated database retrieval system