KEGG   Saccoglossus kowalevskii (acorn worm): 100373185Help
Entry
100373185         CDS       T04123                                 

Definition
(RefSeq) fatty acid desaturase 2-like
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00592  alpha-Linolenic acid metabolism
sko01040  Biosynthesis of unsaturated fatty acids
sko01100  Metabolic pathways
sko01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    100373185
   01040 Biosynthesis of unsaturated fatty acids
    100373185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sko01004]
    100373185
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     100373185
Lipid biosynthesis proteins [BR:sko01004]
 Desaturase
  Front-end
   100373185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5
Motif
Other DBs
NCBI-GeneID: 100373185
NCBI-ProteinID: XP_006822674
LinkDB All DBs
Position
Un
AA seq 434 aa AA seqDB search
MGKGGDDVRNGVTRTFTRKEVEQHNQRSDQWVVVNHKVYDITEWCHRHPGGRRVISHYAG
EDATEPFTAFHPDKVLVGKFLKPLYLGDLCEEDQKLPEIVEDFRNLRKEAEEMSLFEANM
CFFSAHLGHILLLEFLGWFNLWYFGTGWVPYMVTAFILTTMQAQAGWLQHDLGHLSVFKT
STLNHWAHKFVIGGLKAASATWWNFRHFQHHAKPNIVTKDPDVQAPYLFLLGDKMPQIWG
KRKKGFMPYNWQQDYFFLLGPPLLLPIDFHIENLRCVFKWRLWNDLAWTVFFFIRFFAMY
TPLLGGWGAFGLYMFVRFIESHWFVWVTQMNHIPMDIDKESHKDWLTLQLQATCNVDQSF
FNDWFTGHLNFQIEHHLYPTMPRHNYHKIAPLCKSLCQKHGLKYESKSLGTAFVDIVRSL
KKSGELWYEAYYYG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggcggagacgatgtcaggaacggcgtgacgagaacatttaccagaaaagag
gtggaacaacacaaccaacgtagcgatcaatgggtcgttgttaaccacaaagtgtacgac
atcacggaatggtgccaccggcacccgggtggacggcgtgtcatcagccactatgccgga
gaggatgcaacggagccattcacagcattccatcctgataaagttcttgttggtaaattc
ttaaaaccactctaccttggggatctttgtgaagaagaccagaaattgccagagattgtc
gaagatttcagaaaccttcgcaaggaagctgaagaaatgagtttatttgaagccaacatg
tgcttcttttctgctcatttgggacatattttgttgctggaattcttaggttggttcaat
ttatggtattttggtactggttgggttccttatatggtgacggcatttattctcacaact
atgcaggcacaggcaggttggttacagcatgaccttggacatctttctgtcttcaagaca
tcaacattgaatcactgggctcataaatttgtaattggtggacttaaggccgcatctgca
acttggtggaatttccgacattttcaacaccacgccaagcccaatattgttaccaaagat
cccgatgttcaggcaccatatttatttctacttggtgataaaatgccccaaatatggggg
aagagaaaaaaggggttcatgccatataactggcaacaagactacttctttttacttggt
ccaccattactgctgccaattgatttccacatagagaacctacgatgtgtgtttaaatgg
agattatggaatgatttggcatggactgtatttttctttattcgattctttgcgatgtat
actccattacttggtggttggggagcgtttggactctatatgttcgtaaggtttattgaa
agtcactggtttgtatgggtgacacagatgaaccatattccaatggacattgataaagag
tctcacaaagattggttaactttacaactccaagccacatgtaatgttgatcagtctttt
tttaatgactggtttactggacatttaaactttcaaattgaacaccatctctatccaacc
atgccgagacataattatcacaagatagcacctctatgtaaatcattatgtcagaaacat
ggcttgaagtatgaatccaaatctttgggcacagcatttgttgatattgtgagatctctg
aaaaaatctggagaactttggtatgaagcgtattactatggttaa

DBGET integrated database retrieval system