KEGG   Saccoglossus kowalevskii (acorn worm): 100374692Help
Entry
100374692         CDS       T04123                                 

Definition
(RefSeq) fatty acid synthase-like
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00061  Fatty acid biosynthesis
sko01100  Metabolic pathways
sko01212  Fatty acid metabolism
Module
sko_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100374692
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sko01004]
    100374692
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    100374692
Enzymes [BR:sko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     100374692
Lipid biosynthesis proteins [BR:sko01004]
 Fatty acid synthase
  Animal type
   100374692
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100374692
  Exosomal proteins of breast milk
   100374692
  Exosomal proteins of colorectal cancer cells
   100374692
  Exosomal proteins of bladder cancer cells
   100374692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C KAsynt_C_assoc Thioesterase PS-DH ADH_zinc_N PP-binding adh_short ADH_zinc_N_2 Thiolase_N Methyltransf_12 Methyltransf_23 ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 100374692
NCBI-ProteinID: XP_002737768
LinkDB All DBs
Position
Un
AA seq 2541 aa AA seqDB search
MDDVVISGIGCRLPESDNLEEFWQHLINKDDMVTEDNRRWEPGLHGLPKKNGKIKDLSRF
DASFFGVHPKQANTMDPQLRIFMELTYEAIVDAGIDPQILRGTNTGVFVGASGSETIDAI
ASDAETLLGYSMTGCCPAMFANRISYFFDFKGPSYQLNTACSSSLLAMEHALRAIRSGQC
DAAIVAGLNINVKPNTSVQFMKLGMLSPEGQCKSFDVQGNGYCRSEGCVAILMMKSSVAK
RVYSTVVHGGTNTDGYKDQGVTFPSGAEQKKLVERVYKEAGVDPKDVVYVEAHGTGTKVG
DPQEINAIVDVFGKDRNKDNPLLVGSVKSNMGHPEPAAGLAAVAKIILAMEKGIIPPNLH
FNNANLDIPGLHDGRLKVVDEPMELPDGLIGINSFGFGGSNVHMILKPHSKRSLHIPKSD
VRLLHCCARTQEGLDNLLSDVEEYEKMPDFVSLINNVCNQPATGFPYRGYKIINSENKLQ
EAQQITDNEPRPIWYVFSGMGTQWQGMGKDLMKLNTYRKSILKCTEALKDTDINVYNTIM
GSDENTYKDVIKSFVGLAAIQVGLVDLLKSMGVEPDGIIGHSVGELGCGYADGCLTAEET
VLAAYWRGKCVIDAELPAGGMAAVGLTWEEAKQMCPDGVVAACHNAEDTVTISGPKAKVA
DFVSDLKQQGIFAKEVNSSNVAFHSYYMAQIAPNLKNALTKVIKNPRERSPRWISSSIPQ
DKWNTKLAKYSSADYHVNNLVNPVLFQEALSHVPSNAITIEVSPHCLLQAILKRSLSSNC
AFIGLMKRNYPNNLEFFLSNIGKCYLNGMTLNINKLFPEVQYPVMRSTPSIAPLIHWDHS
QQWHVPKAKDFSTGSGQSNAVVSYIIDVSPSSEDHYLHDHCIDGRVLYPATGYLQLAWKT
LAKIRGLPYQQIPVVFEDVTIHRATILPSQGEVTLEVCLAPTTGIFEVSESNQLCVSGKV
EIAGEPLEILDVLEDEEGSTVDTGLLELSASDVYKELRLRGYDYGATFQGITRADNSGNQ
GMLAWNGNWVSFTDTMLQIQILRQPGRSLRLPTRIRSIRIDPVEHIKRVICEQGGQTEVK
VTVGTYTDRCIAGGIEINGLHATVAPRRQQQQTPPTLERSLFIPYSENRIAEGDAELVRY
QKVCEKYAIDLLFQVQEKCQQQQIDVPNSKLMQEMTNEMKSRLIVIDDINKYTQDPQCGL
MKVMTEIYNVEMSESFTEDVRNKLDLNSDLVQNDKLLSVLTNGRYLKNCLDVVMENTPGM
KMKIMEVGVRGSGFYSKVVPALNSHPLLQLDYTVSNQSEEVMSLKEEEFQQFGVSTMKWD
LSESPPSDVNSSDLVIAEGLARVSNIPSALSNISSALVDGGFLLLHERTTNFAVPAVLEI
LSQDISNNNSLKRQYEIFLTQDQWVKVLELANFEIVSQKSDGLQSTIFLCRKQVSFTEES
YVLAVNGANYEWVDTLKETISNFQEKHAKDTIWLLVDGAMDSGIVGMINCLKQEPGGNRL
RCILNASLENDTKLLDLNDNDKTLEKIMQQDLVMNIYRDGEWGSFRHVPFSTATKSSTIL
TPHAYVNVLTRGDLSSLKWIASPLRYATSESLGQNKEICNVYYASLNFRDIMLATGKLPP
DALPGNVASHDCVLGMEFSGRNSTGQRVMGLVTAKGLATTVSVDKDFTWAIPQSWTMEEA
ASVPVVYATVYYALIVRGQLRKGESVLIHSGSGGVGQAAISVALHHGCQVFTTVGSQEKK
DYLMTRFPEMNEEHFGNSRDSSFEQKILIATKGKGVNVVLNSLAEQKLQASVRLLARHGR
FLEIGKYDLSNNSPLGMSLFLRNVTFHGILLDALFEGDNPDWQLVYDLVSQGIXXXXXXX
LNSSQIHNNNTNISFFIIQIMFSQVCNEESGCVTVPSPVQMPAISRSVCHPKKTYIITGG
LGGFGLELANWLVERGALHLVLTSRSGIRNGYQSRCVKQWRNLGVHVTVSTVDITECDGA
EKLIEDSSQIAPIGGLFHLAMVLKDGLFENQTPETFQSVCAAKYVGTCNLDQATRKLCAE
SMDWFVVYSSIVSGRGNAGQTNYGFANSAMERICEKRYYDGYPALAIQWGAIGDVGIIQD
TMGDNNTVVGGTLPQRIGSCLSVLDTFLVQSHPVVSSYVLAEKSTGVKNDQTSTKATLVD
SVAHILGVQDPSTLNPTTTLADLGLDSLMGVEIRQTLERDYDIVMPMRDIRQLTVNKLNE
LSDSEASTLTKKDIKQVAINVEKTTSTAADVLSAPSPKTIVDLHKIENDENHPLFIIHPI
EGTVTLLKDLACKLQCTCYGIQCTPDVPTDTIESMAQYYIDRMQAIQPVGPYRLAGYSFG
ASVAFEMALQLQSQENTDSKLEQLILLDGSHAYVSAHTQTYREKFTVGDENEAETAAMCA
FVQNFIPVNYTLLKEELASCESLQSRLHLASNKIVSVYPTQDKDVLMVEAEAFYRRLLAG
DAYNPISKYSGDVLLFRAKTGSESGDNLGEDYGLNLVCDGIITTYQIDGDHTTFIQGQSA
NEIAIIVNNLFAGQRYTNVEA
NT seq 7626 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgttgtcattagcggtataggatgcaggttgccagaatctgataatttggag
gaattctggcaacatctcatcaacaaagatgacatggtaacagaagataacagaagatgg
gaaccaggtcttcatggcttaccgaagaaaaatggcaaaattaaagatctaagcagattt
gatgcttccttttttggtgttcacccaaagcaagcaaacaccatggacccgcagctaaga
atattcatggagttaacttatgaagcaatagtcgatgcaggtattgatccccagatattg
agaggcaccaatactggtgtatttgttggtgccagtggatcagaaacaattgatgcaatt
gccagtgacgctgagacattacttggatacagcatgactggttgttgtcccgccatgttt
gctaatagaatatcctatttctttgactttaaggggccaagttatcagttgaatacagca
tgctcatccagtttacttgcaatggaacatgccttgagagctatccgcagtggtcagtgt
gatgccgccattgtagctggtcttaatataaatgtcaaacccaatacatcagtgcagttt
atgaagcttggtatgctgtctcccgagggacagtgcaagtcatttgatgtacaaggtaat
ggatattgtagatctgagggatgtgttgcaattttaatgatgaagtcctctgttgctaag
agagtatattccacagtagtccatggcggtaccaacactgatggctataaggaccaaggt
gttacatttccttctggtgctgaacagaaaaaacttgtagaaagagtttacaaagaagcg
ggtgttgatcccaaagatgttgtatatgtcgaagcacatggtacaggtacaaaggtcggt
gatccacaagaaatcaacgctattgttgatgtctttggtaaagatagaaacaaagacaat
cctctacttgttggttccgtgaaatcaaacatgggtcatccggaacctgctgctggactt
gctgctgttgccaaaataattctagccatggaaaaaggaatcatcccaccaaatctgcat
ttcaataatgccaaccttgatataccgggactgcatgatggtagactcaaagtagtagat
gaacctatggaattaccggatggtttgattggaattaattcattcggttttggtggttcc
aatgttcatatgattcttaaaccacacagcaaaagatcgttacacattccaaaaagcgat
gttagactcctccactgttgtgcccgaactcaggagggtttggataatttactgtctgat
gttgaggagtatgagaaaatgcctgattttgtatcattgataaataatgtttgcaaccag
ccagcaactggattcccgtacagaggatacaagattataaacagcgagaataaattacaa
gaagctcaacagataactgacaatgagcctcgaccgatatggtacgtattttctggtatg
ggtacacagtggcaaggcatgggtaaagacttgatgaaactaaacacttataggaaatct
atcttgaaatgtacagaggcattaaaagacacagacatcaatgtgtacaacacgataatg
ggcagtgatgaaaatacctataaagatgtgatcaagtcatttgtaggacttgctgctatt
caggtcggtttggtagacctcttaaaatccatgggtgtggaacctgatggtattattgga
cattcagttggtgagttaggttgtggttatgctgatggctgccttacagctgaagagact
gttcttgctgcttactggagaggcaagtgtgtgattgatgctgaactacctgctggtggc
atggctgctgttggtttaacttgggaagaagccaaacagatgtgtcctgatggcgtggtt
gctgcatgtcataatgcagaagacactgtcacaatatcaggaccaaaagctaaagttgct
gactttgttagtgatctgaaacaacaaggcatatttgctaaagaagtaaacagttccaat
gttgccttccactcctactacatggcccagattgcaccaaatctgaaaaatgctttaaca
aaggttatcaaaaaccctcgtgagagatcaccacgatggatcagttcctctattccacaa
gacaaatggaacaccaaactagccaagtatagctcagctgactaccatgtaaataatctg
gtcaatcctgtgctatttcaagaagccttgtctcatgtaccatccaatgctatcacaatt
gaagtctcccctcattgcctgctgcaagctatcctgaaacgctctctcagttcaaactgt
gcctttattggactaatgaaacgcaactacccaaacaatcttgaattcttcttgtctaac
attgggaaatgttaccttaatggaatgacattaaacatcaacaaactattcccagaagtg
cagtatccagtaatgagaagtacaccatccatcgctccgttgatccattgggaccactca
cagcaatggcatgtcccgaaagccaaagatttctctacgggaagtgggcagagtaatgca
gtggtctcgtacattattgatgtatcaccatcatcagaagaccattatctgcatgatcac
tgtattgatggcagagtgttatacccagccacaggataccttcaacttgcatggaaaact
ctggctaaaatacgtgggttaccataccaacagattccagtggtctttgaagatgtcacc
atacatagagctacaattttgccaagtcaaggagaagtgactctggaagtatgtctagca
ccgactaccgggatatttgaggtttctgaaagcaatcagttatgtgtatctggcaaagta
gaaattgccggtgagccattggaaatccttgatgtcttggaggacgaagaaggcagtaca
gtagatactggattattggagttgtctgctagtgatgtatacaaagaactcagactcaga
ggatatgattatggagcaacttttcaagggataacccgtgctgataattctggcaaccaa
ggaatgcttgcatggaatggtaactgggtatcgtttactgacacaatgttacaaatacag
attttacgacaacctggtaggagccttagattaccaacaagaattagatcaatccgaatt
gatcccgttgaacatatcaagagggtgatctgtgagcagggtggacagactgaagtgaag
gtgactgttggtacatacactgatagatgcattgctggtggtatagagataaatggtctg
catgctactgtggctcccagacgtcaacaacaacaaactccaccaacactagagagatct
ctattcataccatattccgagaaccgaattgcagaaggtgatgcagaattggtgagatac
cagaaggtgtgtgagaagtatgccatagatctgttattccaggtccaagaaaaatgtcaa
cagcaacagattgatgtcccaaactccaaactgatgcaggagatgacgaatgaaatgaaa
tccagactgattgttattgacgacataaacaaatacacgcaggatcctcagtgtggattg
atgaaggttatgactgaaatctacaatgtggagatgagtgaatcatttacagaagacgtc
cggaataaactggacctcaattctgatctggtacagaatgataagttactgagcgttctg
actaatgggagatatctgaagaattgtcttgatgtggtgatggagaacacaccaggcatg
aagatgaagatcatggaagttggtgttaggggaagtggcttctacagcaaagtggttcct
gcattgaattcacatccactgctgcagcttgactatactgtgagcaatcaatccgaagag
gtcatgtcattgaaagaggaggagttccaacagtttggtgtctcaacaatgaaatgggat
ctttctgaatctccacccagtgatgtcaattcatcagatcttgttattgctgagggcctt
gccagagtgtcaaacattccctccgctctgagtaacatatcatcagctttggtagatggt
gggtttctacttttacatgagagaactacaaactttgcagttcctgcagttttagagatc
ttatcccaggatatttctaataacaattcattgaagcgacagtatgaaatctttcttacc
caggaccaatgggtgaaggttttagagctagccaattttgagattgtttctcaaaaatct
gatggtttgcagtccaccatcttcttgtgtcgcaagcaagtttcttttactgaggagtcc
tacgtcttggcagtgaatggcgctaactatgagtgggtagacaccttgaaggagacaatt
tcaaactttcaagagaagcatgcgaaagatacgatttggctgctggttgatggtgcaatg
gattctgggatcgttggtatgattaactgtttgaagcaggaacctggtggaaatagactt
agatgcatcctcaatgctagtctggagaatgacacaaaactacttgacctgaatgacaat
gacaaaacattggaaaagataatgcaacaagacttagttatgaatatttaccgtgatggc
gaatggggatcatttcgtcacgtgccgttcagcactgccactaaatccagcaccatcctg
acaccacatgcatatgttaacgtactgacacgtggtgatctcagctcactgaaatggatc
gcatcacctttgagatatgcaacgtcagaatcccttggtcagaacaaggagatttgtaat
gtttattacgcatctcttaatttccgagacatcatgttagccactggtaaactaccccct
gatgctctaccaggtaatgttgcttcccatgattgtgtattgggaatggaattctctggt
cgtaacagtacaggccagcgtgtcatgggactggtaactgctaaaggtctagcaaccaca
gtgagtgttgataaagacttcacctgggctataccgcagtcatggactatggaggaggct
gcctcagttcccgttgtctatgcgacagtatactatgcactgattgttcgagggcagctg
agaaagggagagagtgttctgatacattctggatcaggtggtgttggacaagctgccatc
tctgtggccctacatcacgggtgtcaagtattcacaacagttggttcccaggaaaagaaa
gattacctaatgacaagattcccagaaatgaatgaagaacatttcggtaattccagagat
tcctcctttgagcagaagatactgatagccaccaagggaaaaggtgttaatgttgtttta
aactcactggctgaacagaagttacaggcaagcgtcaggttactggcacgtcatggtcga
ttcctggaaattggcaaatatgacctttccaataattcaccgctgggtatgtctctgttt
ttgcgtaatgtaacattccatggtatcttgctggatgccctgttcgaaggtgacaaccca
gactggcagttggtttatgatttagtctctcagggaattgnnnnnnnnnnnnnnnnnnta
ttgaatagttcacaaattcacaacaataatactaatatatcattttttattattcaaata
atgttttcacaggtttgcaatgaagaatctggttgtgtaactgttcccagccctgtacaa
atgcctgcaatatcacgtagtgtgtgtcaccccaagaaaacctacatcataaccggtggt
cttggagggtttggtttagagttagctaactggctagttgagagaggagcacttcacctt
gtgctgacatctagatcaggtattcgcaatggctatcagagtcggtgtgtgaaacaatgg
cgtaaccttggtgtccatgtcaccgtctcgactgtagacataactgaatgtgatggagct
gagaaactaatagaagactccagccagattgcacccataggaggactatttcatcttgca
atggttttgaaggatggcttatttgaaaaccaaactcctgagactttccaatcagtctgt
gctgccaagtatgttggtacatgcaatctggaccaagctactcgtaagctctgtgctgaa
agtatggactggtttgttgtgtattcttccattgtgagtggacgtggcaatgctggacag
actaattatggatttgcaaactccgccatggaaagaatatgtgaaaagagatattatgat
ggatatccagcattggccatacagtggggtgctattggtgacgtcggtatcatacaagac
acaatgggtgacaataatacagtggtgggcggtacattgcctcaaagaattggttcttgt
ctctctgttcttgatactttccttgtgcaatcacatccagtggtgtccagctatgtactg
gcagagaaatctaccggtgtcaagaatgaccaaacttcaaccaaagccaccttggttgat
tctgttgcacatattttgggagtccaggacccatccactttgaatcctaccacaactcta
gctgatctgggactggattcgttgatgggtgttgaaattcgccagactttggaacgagac
tacgatattgtcatgccaatgcgtgacatcagacaactcacagtgaataaattaaatgaa
ctttcggatagtgaagcgtctacactgaccaagaaagacattaaacaagttgccataaat
gttgaaaagaccacatctactgctgccgatgtgttatctgcgccttccccaaagactatt
gttgatttacacaagattgaaaatgacgaaaatcatccacttttcatcatccatcctata
gagggcactgttactttattaaaggacttagcatgcaaactacaatgtacatgctatggt
attcaatgtacaccagatgttccaacagacacaatagaaagcatggcacaatactacatt
gacagaatgcaggcaatacagccagttggaccttacagacttgccgggtactcatttggt
gcatctgtggcctttgaaatggcattacaacttcagagccaggaaaacactgacagcaaa
ctggagcagttaatcctattggatggctctcatgcatatgtttctgcacatacacagacg
taccgagaaaagtttacagtgggtgatgagaatgaagctgaaactgccgcaatgtgtgca
tttgtacagaacttcataccagtcaactatacattgttgaaagaagaactcgcttcatgt
gagtctttacaatcacgtctgcatctagcgagcaacaaaattgtcagtgtatatccaacg
caagataaggatgttttgatggtggaagcagaggcgttctacagaagattgcttgcaggt
gatgcttacaatcccatatcaaaatacagcggtgatgtgttattattcagagccaagaca
ggtagcgagtctggggacaatctgggagaagattatggtcttaatctggtttgtgatggg
ataataactacatatcaaattgacggtgatcatacgacttttatccaaggacagagcgcc
aatgaaattgccattattgtgaataatttatttgctggtcaaagatataccaatgttgaa
gcatag

DBGET integrated database retrieval system