KEGG   Saccoglossus kowalevskii (acorn worm): 100378765Help
Entry
100378765         CDS       T04123                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sko00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100378765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sko03019]
    100378765
   04121 Ubiquitin system [BR:sko04121]
    100378765
Enzymes [BR:sko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100378765
Messenger RNA biogenesis [BR:sko03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100378765
Ubiquitin system [BR:sko04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100378765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd TMCO5
Motif
Other DBs
NCBI-GeneID: 100378765
NCBI-ProteinID: XP_006816482
LinkDB All DBs
Position
Un
AA seq 329 aa AA seqDB search
MPQHLETTVVKHLDLIRDKVSNVSDEFATLKVNLDVPALSQNVKSNADRIVIVERAVQKV
EQDLVDVTTRQQGQQPTRGVQAIIDKQSRSIEELKAKTIVLDTKVSTYEGIVAVLNGQIE
RDANVVQAMERERKQDRDLVESLERKIKSQDRIIALKDVALAEQDLRIQSLEMASYDGVL
VWKISDFNRKRNDALSGRTTSIYSPCFFTSRHGYKMCARVYLNGDGMGKGNHVSLFFVIM
RGTFDGLLRWPFRQKVTFMLLDQNNREHVIDAFRPDPTSNSFKRPTGDMNIASGCPLFMP
LSQLESSRHAYVKDDSMFIKVIVDTTDLN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccccagcatttggaaacaactgttgtaaagcatcttgatttgattcgtgataaagta
tccaatgtgagtgatgaatttgcaacactgaaggtgaatcttgatgtaccagcactatcc
cagaatgtgaaaagtaacgccgaccgaatcgtgatagtagaacgtgctgttcagaaggtg
gaacaagacttggttgatgtgaccactaggcagcaaggtcaacaacctacaaggggtgta
caagctatcatcgataagcagtctcgctcaattgaagaattgaaggccaagaccattgta
cttgacactaaggtatctacgtatgaagggattgttgccgtactcaacggtcagattgag
agagatgctaatgttgtgcaggccatggagagagagcggaaacaagaccgagatctggtg
gaatctttagagagaaagatcaaatctcaagatcgcatcatcgcactgaaggatgtcgcc
ttagctgagcaagatctaagaattcagtctctggagatggcatcttacgatggtgtactg
gtttggaaaatctctgacttcaatcgtaaaagaaatgatgccttatctggtcgcactaca
tccatctactcaccgtgcttcttcaccagtcgtcatggttacaagatgtgtgcccgagta
tatctgaatggagatggaatgggcaagggaaaccatgtctccctgttctttgtcatcatg
agaggcacatttgatgggttgctgagatggccattcagacaaaaggtaacattcatgctt
ttggatcaaaacaaccgagaacatgtcattgatgcatttcgtccggaccctacatcaaat
tccttcaagcgtcctactggcgatatgaatattgccagcggctgccctttattcatgcct
ctgtctcaactggagagcagtcgtcatgcttacgtaaaagacgactctatgtttatcaag
gtgatcgtagacactacagatttaaattaa

DBGET integrated database retrieval system