KEGG   Saccoglossus kowalevskii (acorn worm): 102800967Help
Entry
102800967         CDS       T04123                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102800967
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sko03036]
    102800967
Enzymes [BR:sko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102800967
Chromosome and associated proteins [BR:sko03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102800967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 102800967
NCBI-ProteinID: XP_006817845
LinkDB All DBs
Position
Un
AA seq 408 aa AA seqDB search
MASNEQVYRQVAKKRCPRTCSVELEKINISPPRKKQKKYTRFMFYGCSSPSVVSSSSTTL
PDYYPQKKHSSDFLSGYKIPKKKALTSNSSSMKKTTKNNTCSECSSEDSDAPSTLCVPST
SKELSPCKQSSDTKSKSVIISRDITNEREILPIPVINEVDNTKPPDDFFYVTHSRANEVY
YLDSNTVVYCECKDNCFSNTCPCGKDSVKCWYDKDGKLINKFFQLKIMPLIFECNRYCHC
GLKSCKNRVVQKGIQYQLQLFKTPHMGWGVRTVHMIEKGSFVCEYVGELVTDKEANHCND
NYLFDLEKNKDRDAFCLDGTTYGNISRFVNHFCNPNLIPIRVFVEHQDLKCPRIALFAIK
NIKPFEQLGFDYGEKFWSIKNRYFSCKCGSSKCKYPTISSSSSSSDVD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaatgaacaggtctatagacaggtagccaaaaagagatgtccacgtacctgt
agtgtagagctagaaaagataaatatcagtccacctaggaaaaaacaaaagaaatatact
agattcatgttttatggctgcagtagcccttctgtagtttcttcaagttctaccacatta
ccagactattatcctcagaagaaacatagttcagatttcctgtctggatataaaattcca
aaaaagaaagcgttaacttcaaattctagttcaatgaagaaaactacgaaaaataacaca
tgctctgaatgtagcagtgaagattcagatgctcccagtaccttatgtgttccttctacc
tccaaagagctatcaccatgtaaacagtcgtcagatactaagagtaaaagtgtgatcatt
agtcgagatataacaaatgaaagagagattcttcctattcctgtcataaacgaagttgac
aatacaaaacccccagatgactttttctatgtaacacattctcgtgctaatgaagtgtat
tacctggactcgaacactgttgtatattgtgaatgcaaagataactgcttttctaacaca
tgtccctgtggtaaggatagtgtgaagtgctggtatgataaggatggaaagttgatcaac
aaattttttcagttgaaaattatgccattgatcttcgaatgcaacagatattgtcattgc
gggttgaaaagctgtaaaaatcgtgttgtacagaaaggcatacagtatcagctgcagtta
ttcaagacacctcatatgggatggggtgtcagaacagtacatatgatagaaaagggttca
tttgtttgcgagtatgttggagagttggtgacagataaggaagctaaccactgtaatgac
aactacttattcgatctcgaaaaaaataaggaccgtgatgctttctgcttagatggtact
acatatggtaatataagccgcttcgttaatcatttttgcaatccgaacttgattcccatt
cgagtgtttgtagaacatcaggatctgaaatgcccacgcattgccctatttgccattaaa
aacattaaaccctttgagcaactagggtttgactatggtgaaaaattttggtcaattaaa
aacagatatttttcatgtaaatgtggttcttcaaaatgtaaatatccaaccatatcatcc
agcagttcttcatcggatgtagattaa

DBGET integrated database retrieval system