KEGG   Saccoglossus kowalevskii (acorn worm): 102801102
Entry
102801102         CDS       T04123                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
sko  Saccoglossus kowalevskii (acorn worm)
SSDB
Motif
Pfam: Nore1-SARAH C1_1 RA DUF5663
Other DBs
NCBI-GeneID: 102801102
NCBI-ProteinID: XP_006822469
LinkDB
Position
Un
AA seq 361 aa
MVDKVDERKKKIIYSDRGSTTPEKQSIFGGLFGRGKSKGKARRPRSRFYEISGPVDDGAV
SSPPTENEATLASKTTSSAVQIEDDENVPGAGHLFEPCSLINATWCDKCGDFIWGVYKRS
LRCKHCKYTCHHKCVKYVTLDCTELKEEKPSPENTLLTKIPEDVKPGNMTEDEVRRRVES
YNSKSNGLVITMDENGDTFRGFVRVHMNLSRPINVMAGTRPASVFGVIDQQDLKSKKTSF
FLPKGTVKLLHITSDTTSQEVIVALLNKFKILTMRRLSDYERPLLLHLLWGPNNTNRKFV
LQENETGDIMWEAFSIPELQNFLKILDREEKEHLIQVRKKYKVYQEKMKDVMKQNEASLK
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggtggacaaagtagacgaaaggaaaaagaaaattatttattctgatcgtgggagcact
actccagaaaaacaaagtatatttgggggattatttggacgtgggaagtcaaaaggaaaa
gctcggaggccaaggtctaggttttatgaaatcagcgggcccgtcgacgatggggcagta
tcgtctcctcccaccgagaacgaagccacgcttgcaagcaaaacgacgtcgtctgcagta
caaatcgaagatgacgaaaacgtgccgggagccggacacctttttgagccttgttcgctc
ataaatgctacttggtgtgacaagtgtggagactttatttggggagtttataaaaggagc
ttaagatgcaaacactgtaagtacacatgtcatcacaagtgtgtgaagtatgtgacgttg
gattgtacagagttaaaagaggagaaaccatcgccagaaaatactttacttacaaagatt
cctgaggatgtgaagcctggaaacatgactgaggatgaggttagacgacgagtagaaagc
tacaattctaagtcaaatggtttggtcattacaatggatgaaaatggcgatacatttcgt
ggttttgttcgtgtacacatgaatttatctcggcctatcaatgttatggctggaacaaga
ccagcttctgtatttggtgtaatagaccaacaagatcttaaatctaaaaaaacgtctttc
tttctacccaaaggcacagtaaaattattacatattacaagtgacacaacatcacaggaa
gttattgtagctttactcaataaatttaaaatattgactatgagaagactgtctgattat
gagcgaccactacttcttcacttattgtggggtcccaacaatacaaatagaaagtttgta
cttcaagaaaacgaaacaggtgacataatgtgggaagctttcagtattccggaattgcag
aatttcctaaagatactagacagagaggagaaggaacatttgatacaagtacgtaagaag
tacaaggtgtaccaagaaaagatgaaagatgtaatgaaacaaaatgaggcttctttgaaa
atttaa

DBGET integrated database retrieval system