KEGG   Saccoglossus kowalevskii (acorn worm): 102805394Help
Entry
102805394         CDS       T04123                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00480  Glutathione metabolism
sko00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102805394
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102805394
Enzymes [BR:sko01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     102805394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 102805394
NCBI-ProteinID: XP_006820907
LinkDB All DBs
Position
Un
AA seq 245 aa AA seqDB search
MSEEHLASGDPLPPLKDGTIRLYSMRYCPYAQRSRLALLAKGIQYETVNCNLKYKPKWLF
EKNPKGLVPVLEHNGKVVFESLIVNDYLDQAYLGKRRLNNQDIYLKAVDDMVMNVFNGRV
VHPFFRMFAAAKKDKANETKMIKGLIFIDTELKKRGTQFYGGSQPGMLDYNMWPFLERLK
NKEIITGETIFSDKVPLLDKYINDMMEDGPVKETYTLPEVQLKWTTGYVSGNLQYDGLEE
AKPKL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaacatttggcctcaggtgatcctctaccgcctctaaaagatggtacaatt
cgattatatagtatgagatattgtccgtatgcacagaggtcaagattggcgttacttgct
aaaggaatacagtatgaaacagttaattgcaatttaaagtacaaacctaaatggttattt
gaaaagaatcctaaaggactcgtacctgtgttggaacacaatggtaaagtcgtatttgaa
tctttgatagtaaatgactatttggaccaggcgtatcttggtaaaagacgactgaataat
caagacatttacctgaaagccgtggatgatatggttatgaatgtgttcaatggaagggtt
gtacaccccttcttcagaatgtttgctgcggcgaagaaggacaaagctaatgaaacaaaa
atgataaaaggacttatctttattgacacggaacttaagaaacggggaacacagttttat
ggaggttctcagcctggtatgttggattacaatatgtggcctttcttggaaagattgaag
aacaaggaaatcataacgggggaaacaatcttcagcgataaagtaccattattggataaa
tacataaatgatatgatggaggatggtccagtgaaagaaacgtataccttacctgaagtg
cagttgaaatggacaacaggttacgtgtctggtaatctacaatatgacggattggaagaa
gcgaaacccaaattatag

DBGET integrated database retrieval system