KEGG   Saccoglossus kowalevskii (acorn worm): 102806420Help
Entry
102806420         CDS       T04123                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00052  Galactose metabolism
sko00500  Starch and sucrose metabolism
sko01100  Metabolic pathways
sko04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102806420
   00500 Starch and sucrose metabolism
    102806420
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102806420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sko04147]
    102806420
Enzymes [BR:sko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102806420
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102806420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Trefoil
Motif
Other DBs
NCBI-GeneID: 102806420
NCBI-ProteinID: XP_006811253
LinkDB All DBs
Position
Un
AA seq 181 aa AA seqDB search
MSPNFNLLRTCLVLVVLLLLQSTATSALQCIIEDSLRFDCYPESGATKDACQARGCCWRQ
PNLALEQKKYFKDKLATNSVPTCFYPKDFPSYSITSLTETDFGYTAHLSRTTKTYYPKDL
LKLKMDVILETDTRLHFKIYDPDNDRYEVPIDTPAFTNKSYFTILLCGIWTSTIQLWCKE
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccaacttcaatcttcttcgcacgtgtcttgttttagtagtattgttactgcta
cagtcaacagcaacttctgctctgcagtgcatcatcgaagacagtcttcgctttgattgc
tatcccgaatctggagccaccaaagatgcctgccaggcccgtggatgttgttggcgacaa
ccaaaccttgcactggaacagaagaagtatttcaaagacaagttggccacaaattctgtc
ccaacgtgcttctacccaaaagatttccccagctactctataacaagtcttaccgagact
gactttgggtacacagctcatttgtcaagaaccacgaagacgtattatccaaaagatttg
ctaaaactcaaaatggacgttattttggaaacagacacgagactgcatttcaagatttac
gacccagataatgacagatacgaagtaccaattgatacaccagcatttactaataaatcc
tacttcaccatcctactctgtggaatttggacatcgaccattcagctttggtgtaaagag
aaatag

DBGET integrated database retrieval system