KEGG   Saccoglossus kowalevskii (acorn worm): 102809918Help
Entry
102809918         CDS       T04123                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00052  Galactose metabolism
sko00500  Starch and sucrose metabolism
sko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102809918
   00500 Starch and sucrose metabolism
    102809918
Enzymes [BR:sko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102809918
    3.2.1.20  alpha-glucosidase
     102809918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 102809918
NCBI-ProteinID: XP_006819780
LinkDB All DBs
Position
Un
AA seq 926 aa AA seqDB search
MTDTNKRKIYLAVGITAIVVLVIAVPITYFAHPDYNAGPDPVSTLPPDNTADNFKFNCLP
GDQNPTVSKCKKNGCVWNNITVVNPSVPRCYFPQGYGAYRMVGEKPFTWGYRITLDRLDR
PSIYGNDVTRVTLDVQYQTQHRLRFKFYELGSDRFEVPVELPDGGEMATDALYDVSFVSD
PFSMKITRKDTSTVLWDTSVGGFIFADQFLQISTTLPSDYVYGLGEHEHASFRHDMAWQT
WGSFSRDQGPAYKANLYGVHPFYTCLESDANSHGVLLLNSNAMDFTLQPTPALTYRTIGG
VLDFYMFLGPTPEMVVQQYTEAIGRPYMPPYWSLGFQLCRYGYGNLTNVQEVVAGIREYD
IPHDVQYGDIDYMTRQLDFTYEHVTRYKGLPEWVDQLKEEGTRYIIILDPAISAEEVSGT
YPPYDIGTNLGVFITEEDGKTELKGKVWPDPPNIENIMKEIDCSKTGDSWGCSVENYRAE
AVFPDFLNPDARNWWYNLTKDFHDVIAYDGIWIDMNEPANFVEGSVKGCDYNNPLESPPY
KPAIWGATLADKTVCMAAKTHKSSTEISNQYNMHSLFGWSQNEPTLSATRDATGKRSIVV
TRSTFPSSGKYSGHWLGDNASVWPHVHKSIIGMLEFGLFGIPYIGADICGFFEDTTESLC
RRWSQLGAFYPYCRNHNGLNYRRQDPAGFGEEFAKEVRDVLHIRYKLLPYLYTLFHYAHT
EGTTVVRPLMHEFVSDTETWTIDRQMLWGPAFLISPVLDEHVEEIDAYFPDTRWYDYHTG
VEMSKGDRGKYVTLAAPYHYIPLHVRGGYILPTQEAANSTVFSRLKPFGLIVALYDDLNA
KGSLFWDDGDTVDTFENGEYYLAEFHATKDGLNSYIRHDNGQVNGQTMNEILVYGLTSDV
NNVYHNTVKLNVNNWEYDNQKEITHN
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacgaataagaggaagatatacctcgccgtggggattaccgcgattgttgta
ttggtgattgctgtaccaataacgtattttgcgcaccctgattacaacgcaggtccggat
ccggtatcaactttacccccagacaacacggctgataatttcaagttcaactgccttcct
ggagatcagaacccaaccgtctcaaaatgtaaaaagaatggctgcgtttggaataacatt
acagtagttaatccgtcggtgcctcgctgttactttccacagggctatggggcttatcgt
atggtcggcgaaaaacccttcacctggggttacaggatcactctcgatcgactggataga
ccgtcaatttacggtaatgacgtcactcgagttacattggatgttcaatatcagactcaa
catcgtctacgttttaagttctatgaactcggtagcgaccggtttgaagtaccagtagaa
ctgcccgacggtggtgaaatggcgacggacgcattgtatgacgtcagttttgtgtcagac
ccattctctatgaaaataactcgcaaggacacatccacggtgttatgggacacatcagtg
ggaggattcattttcgccgatcaatttctgcaaatatccaccacactgccttccgactac
gtatatggattgggagaacatgaacatgctagtttccgacacgacatggcgtggcaaaca
tggggatccttctcccgtgaccagggaccagcttataaagctaacttatacggagttcat
ccattctacacgtgcctggagagcgacgccaactctcacggtgtattgttgctgaacagt
aatgctatggattttactttgcagccgacaccggctcttacatacaggacgataggaggc
gtacttgacttttacatgtttctgggtcccaccccggagatggttgtgcaacagtacaca
gaggcgataggaagaccgtacatgccgccatattggtcgttgggatttcaactttgtcgc
tatggttacggtaacctaacaaatgtgcaagaggtggtagctggaattcgagagtacgac
attccccacgatgtgcaatatggcgatattgattatatgacgcgtcaacttgattttaca
tatgaacacgtgactcgttacaaaggtctaccagaatgggtggatcaattaaaagaagaa
gggacccgttatatcatcattctcgacccagcgatcagtgcagaagaggtatccggtacg
tatccaccctacgatattggtactaatttgggggttttcataacagaagaagatggaaag
acggaactgaaaggaaaggtttggccggatccaccaaatatagagaacattatgaaggag
atcgactgtagcaagacaggagattcatggggctgctcagttgagaattatcgagccgag
gccgtcttccctgactttttgaacccagatgcacgtaactggtggtataatttaacaaag
gacttccatgacgtcatagcttacgatggtatttggattgatatgaatgaaccggcaaac
tttgtggaaggctcggtaaaggggtgtgactacaataatccgttagaatcgccgccatat
aaaccagctatatggggagcgacgctcgccgacaaaacagtgtgcatggcggcaaagaca
cataaatcatcgacagaaatcagtaaccagtataacatgcatagtttatttggatggagt
caaaatgaaccaacactgagtgcaacaagagacgcaactggtaaaagatccatcgttgtc
actcgatctacctttccaagcagcggtaaatactcgggccattggttaggtgacaatgct
agcgtttggccgcatgtacataagtctattataggaatgctggaattcggtttatttggc
ataccatatattggtgccgatatatgtggattttttgaagacactacagaatcattgtgc
agacgctggtctcaactcggtgccttttacccgtattgtcgtaatcacaatggtctgaat
tacaggagacaagatccagctggatttggtgaggagtttgcgaaggaagtgcgagatgtc
ttacacatacgatataaattattaccatatctttatacgttgtttcattatgctcacaca
gagggcactacagtagtgaggccattgatgcacgaatttgttagcgatactgaaacatgg
accattgatagacagatgttatggggtccagcttttctgatatctcccgtattggacgag
catgttgaagaaattgatgcatacttcccagacacccgttggtatgactaccatactggt
gtggagatgtctaagggggatcgtggtaaatacgtgacactcgctgcaccatatcactac
ataccattacatgtacgcggaggatatatactccctacacaagaagctgctaattcaaca
gtcttcagtcgactgaaaccgtttggtttaattgttgcgttatacgatgatttaaatgcc
aagggctcactgttctgggatgatggagacacagtcgatacttttgagaatggcgaatat
tatttggctgaattccacgcaactaaggatggattaaacagctatatacgccacgacaat
ggtcaagttaatggtcaaacaatgaatgaaatacttgtatatggattaactagtgacgtc
aacaatgtatatcataatactgtaaaacttaacgtcaataattgggaatatgataatcag
aaggagattacgcataactaa

DBGET integrated database retrieval system