KEGG   Sphingomonas koreensis: BRX40_01100Help
Entry
BRX40_01100       CDS       T04828                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
skr  Sphingomonas koreensis
Pathway
skr00620  Pyruvate metabolism
skr00680  Methane metabolism
skr01100  Metabolic pathways
skr01120  Microbial metabolism in diverse environments
skr01200  Carbon metabolism
Module
skr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRX40_01100
  09102 Energy metabolism
   00680 Methane metabolism
    BRX40_01100
Enzymes [BR:skr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BRX40_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APR51212
UniProt: A0A1L6J5I7
LinkDB All DBs
Position
215467..218142
Genome map
AA seq 891 aa AA seqDB search
MASAPPITNNPDIRYLGRVLGDVIRAYGGEALFRRIEYIRSASVDRHRGIAGADSIDPGL
GSLNLDDTLDFVRSFMLFSMLANLAEDRQGVAAETGADVEHAIARLKEHGVDAARIAELL
DHALVAPVLTAHPTEVRRKSMIDHRNRIAELMALKDRGIVETADGDLVDEAVVRQVALLW
QTRVLRPERLYVADEVETALSYMRDVFLPVLPALHARWDRALGSRVPAFLRPGNWIGGDR
DGNPFVTADSLRLTLSRSAETVLNHYLDAVHALGAELSISSHHAEIDPGVVALADASGDA
AASRADEPYRRALSGIYARLAATYRDLTGKAPPRPGALTGERYPDPAAFRVDLATVAHGL
AAQGAETLASSGALGRLIRSVDIFGFHLATLDMRQNSAVHERVVAELLKVAGVEADYAAL
DEPARVELLRRELASPRPLTSRYATYSDETASELAIVQAAAEAHQRYGRAAIRQYIVSMA
QSVSDLLEVHVLLKEAGLYIPGDEPQAHVMAVPLFETIADLDAGPDIMRAWFALPEVAAI
AGKRGHQEVMIGYSDSNKDGGYLTSTWGLSKGSTALKPVFEEAGIGMQLFHGRGGAVGRG
GGSSFQAIQAQPAGTVQGRIRITEQGEVIAAKYGTRESAQTNLEAMASATLLASLEPQQL
STADAARFEAAMEELSGTAFKAYRGLVYGTDGFTSFFRQMTPIAEIAGLKIGSRPASRKK
SDAIEDLRAIPWVFSWAQARVMLPGWYGVGAALSDFRDRGLLREMAAGWPLFASALANME
MVLAKSDMGIAARYAGLVEDRALGDAIFGRIRDGWQSTHDQLLEVTRQTRLLEKHPALET
SIKLRLPYIEPLNLLQVELLKRHRAGETDPKIEQGILLSINAIATALRNSG
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgctccaccgatcacgaacaaccccgacatccgctatctgggccgcgtcctt
ggcgacgtgatccgcgcctatggcggggaggcattgttccggcgaatcgaatatatccga
tcggcatcggtcgaccggcatcgcggcatcgccggcgcggacagcatcgatccgggcctc
ggcagcctgaacctcgacgacacgctcgatttcgtgcgcagcttcatgctgttctcgatg
ctcgccaacctggctgaggaccggcagggcgtggcggcggagacgggcgccgatgtcgag
cacgcgatcgccaggctcaaggagcatggcgtcgatgccgcccggatcgccgaactgctc
gaccatgcgctggtcgcgccggtgctgaccgcccacccgaccgaggtgcggcgcaagtcg
atgatcgaccatcgcaaccgcatcgccgagctgatggcactcaaggaccgcggcatcgtc
gagactgctgatggcgatctggtcgacgaagcggtggtgcggcaggttgcgctgctgtgg
cagacgcgcgtgcttcggcccgaacgcctctacgtcgcggacgaggtcgagactgcgctg
tcctacatgcgcgacgtgttcctgccggtcctgcccgcactccacgcgcgatgggaccgc
gcgctgggcagccgcgtgccggcgttcctgcgcccgggcaactggatcggcggcgaccgc
gacggcaatcccttcgtcaccgccgattcgctgcggctgaccctgtcgcgctcggccgag
acggtgctcaaccactatctcgatgcggtccatgcgctcggcgccgagctatcgatctcg
agccaccacgccgaaatcgatcccggcgtcgtcgccctcgccgacgccagcggcgacgcc
gccgccagccgcgccgacgaaccctatcgccgcgcgctgtcgggcatctacgcccggctc
gccgcgacctatcgcgatctcaccggcaaggcaccgccacgccccggggcgctgaccggc
gaacgctatcccgatcccgcggcgttccgcgtcgacctcgccaccgtcgcgcacggtctt
gccgcgcagggcgccgagacgctggcgtcgagcggcgcgctcggccggctgatccggtcg
gtcgatatcttcggcttccacctcgccacgctcgacatgcgccagaacagcgcggtgcat
gagcgcgtcgtcgccgagctgctcaaagtcgcgggggtcgaggccgactatgccgcgctc
gacgagcccgcgcgggtcgagctgctccgccgcgaactcgcctcgccgcggccgctcacc
agccgctacgcgacctattcggacgagaccgcgtccgaactggcgatcgtccaggccgcg
gccgaggcgcaccagcgctacggccgcgcggcgatccgccagtatatcgtgtcgatggcg
cagtcggtgtccgacctgctcgaagtccatgtcctgctcaaggaagccgggctctacatc
cccggcgacgaaccacaggcgcatgtcatggcggtgccgctgttcgagacgatcgccgat
ctcgacgccgggcccgacatcatgcgcgcctggttcgcgctgcccgaggtcgcggcgatc
gccggcaagcgcgggcatcaggaagtgatgatcggctattcggactcgaacaaggacggc
ggctacctcacttcgacctggggcctctccaaaggttcgaccgcattgaagccggtgttc
gaggaggccgggatcggcatgcagctgttccatggccgcggcggcgcggtcgggcgcggc
ggcggatcgtcgttccaggcgatccaggcgcagcccgcgggcacggtgcagggccgcatc
cgcatcaccgaacagggcgaggtgatcgcggcgaagtacggcacgcgcgagagcgcgcag
accaacctcgaggcgatggcgtcggcgacgttgctcgcgagcctcgagccgcagcagctg
agcaccgccgatgccgcgcggttcgaggcggcgatggaggaactgtcgggcaccgcgttc
aaggcgtatcgcgggctggtctacggcaccgatggcttcaccagcttcttccgccagatg
acgccgatcgccgagatcgccggcctcaagatcggcagccgccccgcgagccgcaagaag
agcgacgcgatcgaggatctgcgcgcgatcccctgggtgttcagctgggcgcaggcccgc
gtgatgctgccgggctggtacggcgtcggcgcggcgctgtcggacttcagggaccgcggg
ctgctgcgcgagatggcggcgggctggccgctcttcgcctcggcgctggcgaacatggag
atggtgctggccaagtccgacatgggcatcgctgcgcgctacgccggactggtcgaggat
cgtgcgctgggcgatgcgatcttcgggcgcatccgcgacggctggcagtcgacgcacgac
cagctgctcgaggtgacgcgccagacgcggctgcttgagaagcatccggcgctcgaaacg
tcgatcaagctgcgcctgccctatatcgagccgctcaacctgcttcaggtcgagctgctc
aagcgccaccgcgcgggcgagaccgatcccaagatcgagcagggcatcctgctgtcgatc
aatgcgatcgcgacggcgctgcggaattcggggtaa

DBGET integrated database retrieval system