KEGG   Sphingomonas koreensis: BRX40_01555Help
Entry
BRX40_01555       CDS       T04828                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
skr  Sphingomonas koreensis
Pathway
skr00040  Pentose and glucuronate interconversions
skr00051  Fructose and mannose metabolism
skr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRX40_01555
   00051 Fructose and mannose metabolism
    BRX40_01555
Enzymes [BR:skr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BRX40_01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 TyeA
Motif
Other DBs
NCBI-ProteinID: APR51290
UniProt: A0A1L6J6X8
LinkDB All DBs
Position
complement(326337..327317)
Genome map
AA seq 326 aa AA seqDB search
MSNQKYGAGIWHFATFVDRYATDGYGPARSLIEMIDIAGQVDDLSVVDINYPFVDPSLSL
DTVEEALKRNNLSVIGITPEIYTRQFAKGAFTNPDAGIRRLANEMCNDAANVVRRFGADY
VKLWPGQDGWDYPFQVDHRKLWQQSVEGIGELASQNPDLKFVIEYKPREPRCHMSYDSVS
RTLLGIERMGLPNVGILLDFGHALYGGESPADSAQLAIDHGRLFGMDVNDNFRGWDDDLM
AGSVHPIELFEFFYTLRKNQWEGVWQLDQFPFREDSVAVANGAISFLKGIERALDKLDFE
AMQDAQDRHDAVTALRLAREALFTSF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatcagaaatacggggccggcatctggcacttcgcgaccttcgtcgatcgctat
gcgaccgatggctatggcccggcgcggtcgctgatcgagatgatcgatatcgccgggcag
gtcgatgacctgtcggtggtcgacatcaactatccctttgtcgaccccagcctgtcgctc
gatacggtcgaggaggcgctcaagcgcaacaacctctcggtcatcggcatcacgcccgaa
atctacacgcgccagttcgccaagggggccttcaccaaccccgatgccggcatccgccgc
cttgccaacgagatgtgcaacgacgccgcaaacgtcgtccgccgtttcggcgcggactat
gtgaagctctggccgggccaggatggctgggactatcccttccaggtcgatcaccggaaa
ttgtggcagcagagcgtcgagggtatcggcgaactggccagccagaatcccgacctcaaa
ttcgtgatcgagtacaagccgcgcgagccgcgctgccacatgagctatgacagcgtgtcg
cgcaccctgcttggcatcgagcggatggggctgcccaatgtcggcattctgctcgatttc
ggccatgcgctgtacggcggcgagagcccggcggattcagcgcagctcgcgatcgaccac
ggccgcttgttcggcatggacgtgaacgacaatttccgcggctgggacgatgatctgatg
gccggatcggtccatccgatcgagctcttcgaattcttctacacgctgcgcaagaaccag
tgggagggcgtgtggcagctcgaccagttcccgttccgcgaggattcggtcgccgtcgcc
aatggcgcgatcagcttcctcaagggcatcgaacgcgcgctcgacaagctcgacttcgag
gcgatgcaggacgcgcaggaccgccacgacgcggtgaccgcgctgcggctggcgcgcgaa
gcgctgttcacgtccttctga

DBGET integrated database retrieval system