KEGG   Sphingomonas koreensis: BRX40_05890Help
Entry
BRX40_05890       CDS       T04828                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
skr  Sphingomonas koreensis
Pathway
skr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:skr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRX40_05890
Enzymes [BR:skr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRX40_05890
Transporters [BR:skr02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRX40_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APR52029
UniProt: A0A1L6J7Z9
LinkDB All DBs
Position
complement(1182927..1183595)
Genome map
AA seq 222 aa AA seqDB search
MWQLYQFPLCPFSRKVRLVLGEKGVGYEPVRESPWARRDEFLDMNPAGQTPVMADDRGVV
LIDSVAICEFFEETVSKAALLNGTAADRAEIRRLVAWFDVQFFRDITGPLLHERMLKRIV
QRATPDSTALREAMKAAVAHLDYIDFLLDHRTWLGGATMSLADLAAAAQISVADYLGGID
WKSHEQAKRWYVGMKSRPSFRPLLAERMEGINPPPEYEKLDL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctctatcaatttccgctttgccccttctcgcgcaaggtcaggctcgtcctt
ggtgagaagggagtcggctatgagccggtgcgcgaatccccctgggcgcggcgcgacgag
tttctcgacatgaaccccgcggggcagacccccgtgatggccgacgatcgcggcgtcgtg
ctgatcgattcggtcgcgatctgcgagttcttcgaggaaacggtcagcaaggccgcactg
ctcaacggcaccgcggcggaccgcgccgagattcgccgtctggtcgcctggttcgacgtc
cagttcttccgcgacatcaccggaccgctgctgcacgagcggatgctcaagcggatcgtt
caacgcgcaaccccggattcgaccgcgctgcgcgaagcaatgaaggcagcggtcgcgcat
ctcgactatatcgacttcctgctcgatcaccgcacctggctgggcggtgcgacgatgagc
ctcgccgacctcgccgccgcagcgcagatcagcgtcgccgactatctgggcgggatcgat
tggaagagccacgagcaggccaagcgctggtatgtcggaatgaaaagccgccccagcttc
cgcccactgctcgccgaacggatggaggggatcaacccgccgcccgaatatgaaaagctg
gatctttag

DBGET integrated database retrieval system