KEGG   Sphingomonas koreensis: BRX40_15230
Entry
BRX40_15230       CDS       T04828                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
skr  Sphingomonas koreensis
Pathway
skr00290  Valine, leucine and isoleucine biosynthesis
skr00660  C5-Branched dibasic acid metabolism
skr01100  Metabolic pathways
skr01110  Biosynthesis of secondary metabolites
skr01210  2-Oxocarboxylic acid metabolism
skr01230  Biosynthesis of amino acids
Module
skr_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:skr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    BRX40_15230
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BRX40_15230
Enzymes [BR:skr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     BRX40_15230
    4.2.1.35  (R)-2-methylmalate dehydratase
     BRX40_15230
SSDB
Motif
Pfam: Aconitase_C Septin
Other DBs
NCBI-ProteinID: APR53595
UniProt: A0A1L6JCG0
LinkDB
Position
complement(3120514..3121143)
AA seq 209 aa
MEPVKKVEGRAYPWGAKNIDTDIIIPAHWLKTISREGLGKGAFESVRAEPDNIFDDARYA
GSPILIAGENFGCGSSREHAAWALKDMGVTAVIAPSYSDIFSGNAFKNGIVAVVLPQDAV
DRLVEVAKTDPVTIDLETMTVTTPYQDRFAFEMDPFRRDCLMQGLDEVGLTLAKDTVISK
YESTVAQSRPWIARERADEGLAVAGSGRT
NT seq 630 nt   +upstreamnt  +downstreamnt
atggaaccggtgaagaaggtcgagggacgtgcctatccgtggggcgccaagaatatcgac
accgacatcatcatccccgcccattggctcaagacgatcagccgcgaggggctgggcaag
ggcgcgttcgagagcgtgcgcgcggaaccggacaacatcttcgacgacgcgcgctacgcc
gggtcgccgatcctgatcgcgggcgagaatttcggctgtgggtctagccgcgaacatgcc
gcctgggcattgaaggacatgggcgtcaccgcggtgatcgcgccgagctactccgacatt
ttctccggcaatgcgttcaagaatggcattgttgccgtcgttttgccgcaggacgcggtc
gaccggctggtcgaggtggcgaagaccgatccggtgacgatcgacctcgagacgatgacc
gtcaccaccccctatcaggaccgcttcgccttcgagatggacccgttccgccgcgactgc
ctgatgcaagggctggacgaagtcggtctgacgctggcaaaggataccgtgatttcgaaa
tacgaatcgacggtcgcccaatcgcgcccgtggatcgcacgggagagagcggatgaaggc
cttgctgtcgcgggaagtgggcggacctga

DBGET integrated database retrieval system