KEGG   Salinivibrio kushneri: FCN78_02850
Entry
FCN78_02850       CDS       T05956                                 

Gene name
alaS
Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
sks  Salinivibrio kushneri
Pathway
sks00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sks00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FCN78_02850 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sks01007]
    FCN78_02850 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sks03016]
    FCN78_02850 (alaS)
Enzymes [BR:sks01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     FCN78_02850 (alaS)
Amino acid related enzymes [BR:sks01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   FCN78_02850 (alaS)
Transfer RNA biogenesis [BR:sks03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FCN78_02850 (alaS)
 Prokaryotic type
    FCN78_02850 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Seryl_tRNA_N AsnA DMPK_coil Atg14
Other DBs
NCBI-ProteinID: QCP01430
UniProt: A0A4P8GZY4
LinkDB
Position
1:587425..590007
AA seq 860 aa
MYMSTDEIRTAFLKFFESKGHQIVPSSSLVPADDPTLLFTNAGMNQFKDTFLGVEKRDYT
RATSAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFKQDAIQYAWAFLTETIG
LPKEKLLVTVYETDDEAFDIWHQQIGVPADRIVRIGDKEGGKPYESDNFWQMGDTGPCGP
CSEIFYDHGEHIWGGPPGTPEEDGDRFIEIWNIVFMQFNRQADGTMENLPKPSVDTGMGI
ERIAAIKQGVHSNYEIDVFQQLIKQVAEIIGVEDLTNQSLRVVADHIRSCAYLIVDGVMP
SNEGRGYVLRRIIRRAVRHGNKLGSKEAFFYKLVGPLATIMGTAGEDLRAQQTMVEKVLK
IEEDNFGRTLERGMLMLEEALDKVKGDELDGETVFKLYDTYGFPADLTNDVARERGYRID
EAGFEAAMEAQRQRAREAGQFGTDYNQAIKVEHGSDFCGYTGTEGTGQITEIFVDGDTVD
SLVSGDKAVVILDHTPFYAEAGGQCGDTGVIDTDQGRFTVTDTQKAGQAIAHYGSLSEGQ
LSVGAQATARVDAARRHAVAMNHSATHLLHAALREVLGKHIAQKGSLVRPDGLRFDFSHL
EPVTADELKAVERIVNQQIRENSPVQTEVMDIEAAKQKGAMALFGEKYDDQVRVLSMGDF
SIELCGGTHATRTGDIGMFKIVSEAGIAAGVRRIEAITGQAAIDSVYQQQADYEAKLDEA
QSKAKALEKQIQQLKQKLAAQESAGLINQVRELNGVKVLISQLDGADNKALRSMVDDLKN
QMGSGIVLLGNVANDKVGLIAGVTKDLTGTVKAGELVNLVAQQVGGKGGGRPDMAQAGGS
DVSALPNALASAETWLAEQL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgtatatgagcactgatgagatccgtacagcgtttctcaagttctttgaaagcaaaggg
caccagattgtgcctagctcgtcgctcgtgcctgccgatgacccaacgcttttgttcacc
aacgcagggatgaaccagtttaaagatacttttttaggggttgaaaagcgtgactacacg
cgtgcaacgtcagcacagcgttgtgtgcgggcgggcggcaaacacaacgaccttgaaaac
gtcggttttaccgcgcgccaccataccttctttgaaatgctcggcaatttcagcttcggt
gattacttcaagcaagatgcaattcaatacgcatgggcatttttaaccgaaaccattggc
ttgccaaaagaaaagctgttggtaaccgtatacgaaaccgatgacgaagcatttgatatt
tggcatcagcaaatcggtgtcccagcggatcgcattgtgcgtatcggcgataaagaaggt
ggtaagccttacgagtcagataatttctggcaaatgggcgatactgggccatgcggacca
tgtagcgaaattttctatgatcatggtgagcatatttggggtggcccgccagggacgcca
gaagaagacggggatcgcttcatcgagatctggaatatcgtctttatgcagtttaaccgc
caagcagacggcaccatggaaaatctgcctaagccgtcagtggataccggtatggggatt
gaacgcatagcggcaattaagcagggcgtgcactctaactatgaaatcgatgttttccag
caattgattaagcaagtcgctgagatcattggggttgaagatctcactaaccagtctttg
cgcgtagtcgctgaccacatccgctcgtgtgcatatttgattgttgatggtgtgatgcct
tctaacgaagggcgaggctatgtgttacgccgaatcattcgtcgtgcggttcgtcatggt
aacaagcttggcagcaaagaggcgtttttctataagctggttggccctctcgctaccatc
atggggacggcaggtgaagatctgcgtgcccagcaaaccatggtggaaaaagtccttaag
attgaagaagacaactttggtcgcacgcttgagcgtggcatgttgatgttggaagaggcc
ttggacaaggttaagggtgacgagttagatggtgaaactgtcttcaaactctatgacact
tacggcttcccggcagacttaaccaatgatgttgcgcgtgagcgcggttatcgcattgat
gaagccggctttgaagcggcgatggaagcccagcgtcagcgcgcgcgcgaagccggtcag
tttggcactgactacaaccaagccataaaagtggagcatggctctgatttttgtggttac
acagggacagaaggcacaggccagatcactgagatttttgtcgacggtgacaccgttgat
agcttggtatcgggcgataaagcggtggtgatccttgaccacacgcctttctatgccgag
gccggtggccaatgtggtgatacaggggtgattgacactgaccaagggcgatttaccgtg
acggatacccagaaagcggggcaagccattgcacattacggtagcttgtcggaagggcaa
ctgagtgtcggggcacaagccaccgctcgcgtggatgccgcgcgtcgtcacgcggtagcg
atgaatcattccgcgactcacttgctgcacgccgcactgcgtgaggtactagggaagcac
attgcgcaaaaaggctcgctagtccggcctgatgggttgcgttttgacttctcacacctt
gagccggtcaccgctgacgaactcaaagcggttgagcggatcgtgaatcaacaaatccgt
gaaaatagccccgtgcagacagaagtgatggatatcgaagccgccaagcaaaaaggcgcg
atggcactgtttggtgagaaatacgatgaccaagtgcgtgtattaagcatgggtgacttt
tctatcgagctgtgtggcgggacacacgcgacgcgtacgggcgacattggcatgtttaaa
atcgtctctgaagcgggtatcgcggccggtgtacgccgcatcgaagccattaccgggcaa
gcggccattgatagcgtttatcagcaacaggctgactatgaagccaaacttgacgaagcc
cagagcaaagcgaaagcgttagagaaacaaattcagcagcttaaacagaaactggccgca
caagaaagtgctgggctgatcaatcaggtccgtgagctaaacggggtaaaagtgctgatt
agccagcttgatggtgcggataacaaagcactgcgtagcatggtggatgatctgaaaaac
caaatgggcagtggcattgtgctactcggtaacgtggccaatgataaagtcggcctgatt
gccggtgtcaccaaggatctaaccggcacggtaaaagcgggtgagctggtcaaccttgtc
gcacagcaagtgggtggcaaaggcggtggtcgtcctgatatggcacaagccggcggtagt
gatgtgagtgcactgccgaatgcattagcctccgcggagacctggctcgctgagcaacta
taa

DBGET integrated database retrieval system