KEGG   Salinivibrio kushneri: FCN78_13465Help
Entry
FCN78_13465       CDS       T05956                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sks  Salinivibrio kushneri
Pathway
sks00473  D-Alanine metabolism
sks00550  Peptidoglycan biosynthesis
sks01100  Metabolic pathways
sks01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sks00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FCN78_13465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FCN78_13465
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FCN78_13465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sks01011]
    FCN78_13465
Enzymes [BR:sks01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FCN78_13465
Peptidoglycan biosynthesis and degradation proteins [BR:sks01011]
 Precursor biosynthesis
  Amino acid ligase
   FCN78_13465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: QCP03448
UniProt: A0A4P8H758
LinkDB All DBs
Position
2:complement(81979..82983)
Genome map
AA seq 334 aa AA seqDB search
MTKLNLLLLCGGGGAEHDISLVSARYIESQLAKLPRVKVHKVEMTQDGWHLDDGMRCHLD
TDGNLCSKVELTQIHYVVPCLHGFPGETGDIQSLLTITGLPYLGCDAEGSQICFNKITSK
LWFDALGIPNTPYVFITDQGEQSQARASAFLADHQAVFVKAASQGSSVGCYHVTDAAQLQ
ARIADAFTFSDQVLIEKAIKPRELEVAAFQVGDEIIVTRPGEIRCPEGSFYTYEEKYSEG
SHSNTYIEAENLTEAQVAAIRAYAHQAFKQLRLKDMSRIDFFLTEDNEILVNEINTFPGM
TPISMFPKLMEHHGLAFHEYLASCISTATGRRVN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcaacctgcttttgttatgcggtggcggcggggcagaacatgatatttcc
ctcgtatctgcccgatatattgaatcacaattagctaagttaccccgcgttaaggtgcat
aaagttgaaatgacccaagacgggtggcacctggatgacggtatgcgctgtcatcttgat
actgatggcaacctgtgcagtaaagtggaactcacgcaaattcactatgttgtgccttgc
cttcatggcttcccaggcgaaaccggcgatattcagtcattactgacgatcactggcctg
ccatacttaggatgtgacgcggaaggtagccagatctgttttaataaaataacgtcaaag
ctatggtttgatgcacttggtatccccaacaccccctatgtgtttatcaccgaccaaggc
gagcagagccaagcacgtgcctccgcgtttctagcggaccatcaggcggtgtttgtgaaa
gcggccagccaagggtcgagtgtagggtgttaccacgtaacagatgccgcgcagctacaa
gcccggattgccgatgcattcaccttctcggatcaggtattgatcgaaaaagcgatcaag
ccgcgtgaattagaggtggcagcgtttcaagtgggcgatgaaattatcgtgacacgcccc
ggtgaaatccggtgtcccgaagggagcttttacacctacgaagaaaagtacagcgaaggg
agccacagtaatacctatatagaggctgaaaacctgactgaagcacaagtggcagcaatc
cgtgcctacgcccatcaggcattcaagcaactgcgtttaaaagacatgtcgcgtatcgat
ttcttcttaaccgaagacaacgaaatcttagtcaatgaaattaatacgtttcctggcatg
acgcctatttctatgttccccaaactgatggagcaccatggcttagcattccatgaatac
ttggcatcctgtattagcacggccacgggtcgacgggttaattga

DBGET integrated database retrieval system