KEGG   Sulfuricurvum kujiense: Sulku_1491Help
Entry
Sulku_1491        CDS       T01370                                 

Definition
(GenBank) putative CheA signal transduction histidine kinase
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku02020  Two-component system
sku02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sku00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sulku_1491
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Sulku_1491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sku01001]
    Sulku_1491
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sku02022]
    Sulku_1491
   02035 Bacterial motility proteins [BR:sku02035]
    Sulku_1491
Enzymes [BR:sku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Sulku_1491
Protein kinases [BR:sku01001]
 Histidine kinases
  CheA family [OT]
   Sulku_1491
Two-component system [BR:sku02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Sulku_1491
Bacterial motility proteins [BR:sku02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sulku_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ADR34153
UniProt: E4TZP6
LinkDB All DBs
Position
complement(1508920..1511073)
Genome map
AA seq 717 aa AA seqDB search
MRKYYYGAVAFYLIALLSYITYQYTSQRSELIAKIDQKLIRCASVTDQFLPSSLHTPDMN
AESISPEQDTRNRIALSRFSQSMNVKYVYSFILEDGKVYFTSSSATPQELKSGEDISYYF
DEYTEITPLLLEAFKTRQMQFEESSDQWGHFRSVYLPHVSPSGRVYITGSDMEISDIDAQ
LHDLLINAFIDTLFYTFILIPFFIAYRMHNMTIQNELSRLVDERTADLKERSVAVKRLLD
NANQGFLTFSTSLSVENEYSHKCLEIFGESIDGKPISELLYPEETQKRDFLEQTIQAVFN
EEDEVKVEAILSLLQQEFIIRHKLIQVSYNRIEPNRLMLILTDITDKKNLEINVERERNR
LKMIVAVISNSDEFFELLDEYQSFLSRRSGFVNIDHTPFQNLTELYRLIHTYKGLFAQKD
FITTPQGLHKVESRFSVWLQDETISNETIQAMLTKIDFESWLKKDIDVLRETLGDDFMDK
KSTITIDDETFEILHGKIKELIETQPDECHELSELLEDIRKLKYKPIGEYFASLPKYVEM
ISERLEKSLKPMDVSDTTNISVGEEFKPFAKSLIHVIRNSVDHGIETPEERVENGKDEYG
TILLSITDTEESVVIEISDDGRGINKEKLKQKALERGCKTLLELENDSAVFELMFEDFLS
TKDEISDLSGRGVGLASVRSEVLKLGGSYSVVSEQGKGCRFIFSIPKKSLVRDEDEK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatattattacggtgccgtcgcattttatcttatagcattactttcgtatatt
acctaccaatacacttcccagcgttcggaattgattgccaaaatcgatcaaaaattgatt
cggtgtgccagtgtaaccgaccagtttcttccctcatcactgcatacacccgatatgaat
gctgagtcgatctctccggaacaagatacccgcaaccgtatagcattgtcccgattttct
caaagcatgaacgtcaaatacgtctattcatttattttagaagacgggaaagtttatttc
acctccagcagcgcaaccccccaagagcttaaaagcggtgaagatatcagctactatttt
gatgagtacaccgagataacaccgctgttgttagaagctttcaaaacccgtcagatgcag
tttgaagagtcttcggatcagtggggacatttcaggtcggtttatttgcctcatgtctcc
ccaagcgggcgtgtctatattacaggttccgacatggaaatcagtgatattgatgcacag
cttcatgaccttttgattaatgcgtttattgatactcttttttatacctttattttaata
ccgttttttattgcgtatcggatgcataatatgacgatccaaaacgagctttcccgactg
gttgatgaacgcacagctgatctgaaagaacgttccgtcgccgttaagcggctgcttgat
aatgcaaatcagggttttttgactttttcaacttctttgagtgtggagaacgaatactct
cacaaatgtttggaaatttttggagagagtattgacggcaaacctatcagtgagttgctt
tatccggaggaaacgcagaaaagagactttttggagcaaacgatccaggcagttttcaat
gaggaagatgaggtaaaagtcgaagcgattctttcccttcttcaacaagaatttatcatc
agacacaaattgattcaagtatcctacaatcggatagaacctaatcgattaatgctgatt
ctcaccgatattaccgacaaaaagaatttggaaataaatgttgaaagagaacgtaaccgg
cttaaaatgattgttgcagtgatcagtaacagcgatgagttttttgagctattagatgaa
tatcaaagttttttgtcccgtcggtccggttttgtcaatatcgatcatacgccgtttcag
aatctgacagaattgtaccgtttgattcatacctataaaggtcttttcgcccaaaaagat
tttataaccacaccgcagggacttcataaagtggaatcccgtttctccgtatggctgcag
gatgagacgatatcgaatgaaacgattcaggcgatgctgacgaaaatcgatttcgaatcg
tggcttaaaaaagatatcgatgtgttaagggagacgctgggtgatgattttatggataaa
aaatcgacgataacgattgatgatgaaacatttgagatactgcacggcaaaattaaggag
ttgatagagacgcagccggatgaatgtcatgaattgtcggaacttcttgaggatatacga
aagttaaagtacaagccgattggagagtactttgcttccttgccgaaatacgtcgaaatg
atcagtgaacgacttgaaaaatcactgaaaccgatggatgtatctgacacgaccaatatt
tcagtgggtgaagagtttaaaccgtttgcaaaatctttgatacatgttattcgcaacagt
gttgatcatgggattgaaacccctgaagagagagtggaaaacggtaaagatgaatacggt
acgatcctactctccattaccgatacggaagaatccgttgtgatagaaatcagtgatgac
ggtcgaggaatcaacaaagagaaactcaaacaaaaagcgcttgagaggggatgcaaaact
ctcttggaacttgaaaatgattcagccgtatttgaactgatgtttgaagattttctatcg
acaaaagatgaaatcagtgatctctccggcaggggggtcggattggcctcggtacgttcg
gaagttttgaaactcggagggagctacagtgtagtatccgagcagggaaaagggtgccgg
tttatatttagtattcccaaaaaatcactcgttagggatgaggatgaaaaatag

DBGET integrated database retrieval system