KEGG   Sulfuricurvum kujiense: Sulku_2208Help
Entry
Sulku_2208        CDS       T01370                                 

Definition
(GenBank) peptidase S11 D-alanyl-D-alanine carboxypeptidase 1
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00550  Peptidoglycan biosynthesis
sku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sku00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulku_2208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sku01002]
    Sulku_2208
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
    Sulku_2208
Enzymes [BR:sku01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sulku_2208
Peptidases [BR:sku01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Sulku_2208
Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sulku_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13 Transpeptidase ZnuA
Motif
Other DBs
NCBI-ProteinID: ADR34868
UniProt: E4TWM2
LinkDB All DBs
Position
complement(2231583..2232410)
Genome map
AA seq 275 aa AA seqDB search
MLKSLIFFFLLLCITSLHAEIDSEKLDKLNVEALLVKNLKNNEILYSKEALREVKPASLT
KIMTATLAIEQGELTRLVVISKEMLQVEPTKAGYKEGEIFLLGDLINAAMIKSDNDAAMA
VAIAIGGSIENFNKMMNAKAASIGMVNTVFTNPCGFDIGNHHSTPQDLLTLAEYAIKNPV
FNDITRLNQHTYYSLNTARKFVANTHNQLLNKYEYAVGVKTGYTSKAGPCLIARAKKEDR
DCLIVMLNSKENRWKTAKEIFEQVFVPSQDVLASL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaatctctcatcttcttttttcttcttctatgcattacttctcttcatgccgaa
atcgattctgaaaaactggataaattgaatgtagaagcgttattggtcaaaaatctcaaa
aataacgaaatactctattcaaaagaggcacttcgcgaggttaaaccggcaagtcttact
aaaattatgacggctactttggccatagaacagggagaattaacccgtctggtcgttatt
tccaaagagatgcttcaagtggagcctaccaaagcgggctacaaagagggggaaatcttt
ttattgggtgatctcattaatgcggccatgattaaatcggataacgatgcggcgatggcg
gttgcaatagccatcggaggatcgatagaaaatttcaataagatgatgaatgccaaagcc
gcatccatagggatggtcaataccgtttttacgaacccgtgcggcttcgatatcggcaat
caccactctacgccgcaagatcttctgacactggcggaatatgctatcaaaaatcctgtt
tttaacgatatcacccgcttaaaccagcatacctattattcgctcaatacggcacgaaaa
tttgtcgccaatacccacaatcagcttctaaacaaatatgagtacgcggtcggtgtcaaa
acgggctatacctcaaaagcgggaccatgcttaatcgcccgtgctaaaaaagaagacaga
gattgtctgatcgtaatgctcaattccaaagagaaccgctggaaaaccgccaaagagatt
tttgagcaggtatttgttccttcgcaggatgttttagcctctttgtaa

DBGET integrated database retrieval system