KEGG   Sulfuricurvum kujiense: Sulku_2222Help
Entry
Sulku_2222        CDS       T01370                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00550  Peptidoglycan biosynthesis
sku01100  Metabolic pathways
sku01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sku00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulku_2222
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sulku_2222
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sku01003]
    Sulku_2222
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
    Sulku_2222
Enzymes [BR:sku01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Sulku_2222
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sulku_2222
Glycosyltransferases [BR:sku01003]
 Polysaccharide
  Bacterial polysaccharide
   Sulku_2222
Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Sulku_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ADR34882
UniProt: E4TWN6
LinkDB All DBs
Position
complement(2243171..2245135)
Genome map
AA seq 654 aa AA seqDB search
MRKYLLITVGIAILIPVAFLGYLIYSFEYETQKLIKYQPRLTTEVYDRNGNKIANLFSDE
HRYYVSYENIPPRLIEALLAIEDTTFFEHSGVNPDAVMRAIIKDVSAGKLKEGASTITQQ
LVKNTLLTREKKFSRKFKEVLYSIRIEQELTKEQILERYFNEIYLGHGYYGIKTAADGYF
RKPLKELSLKEMAMLVGLPKAPNFYSPTKNYELSLGRANRVIGRMFDLGWIDQATYEKAT
QERPKVYNDTLSKNSGPYIIDEVMRQLGDAFPDIRSGGYKIYTTIDMRLQEAGYKALQSG
RDEILKRAQEAGDLDENMQRQLNGALISLNPHTGEVLAMVGGYDYSLSPYNRVTQAKRQP
GSAFKPFLYQVALDSGMSPSSLVPDIARTYTYAGNDGEEKTWQPKNYKNEYKGMVTIRDA
LTHSRNLATINMVSDMGFGKITEGLRRFGITENLPPDLSIALGTISISPMDLAKYYTMFA
SGGAMTNPMLIREVITPTGENIKYQNKSRQVDTPQQIYLMTSILKDVVSHGTGTNARVAG
IEIAGKTGTTNDNVDAWFAGYSPTVETIVWFGHDNNTPMRRSETGGRAAAPVFRYYYEDM
LRIYPNTKRYFDVPAGVYVGSGNDGNNSESYTDTSAVPDATQEEAPKTDEKLVF
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatatctgctcataacagtggggatcgctattttgattccggttgcatttttg
gggtatctcatctattcatttgaatatgaaacacaaaaattgatcaaatatcagccccgt
ttgacgacagaagtctatgatcgcaacgggaacaagattgccaatctgttcagtgacgaa
caccgctactacgtttcgtatgagaatatccctccgagattgattgaagcattgttggcg
attgaagatacgactttttttgaacacagcggagtcaatcccgatgcggtaatgcgggcg
atcatcaaagacgtcagtgccggtaagctcaaagagggggcgagtacgattacccagcag
ctggtaaaaaacaccctgttgacccgtgagaaaaaattctcccgtaaatttaaagaggtt
ttgtattcgatccggattgagcaggagttgacgaaagaacagattttagaacgctatttc
aacgagatttatctggggcacggctattacgggattaaaacggcggctgacggctatttt
cgcaaaccactaaaagagttgagccttaaagagatggcgatgctggtcggattgccgaaa
gcgccgaatttttactctccgacaaagaactatgaactctccttagggcgtgcgaaccgc
gttatcggacgtatgtttgacctgggatggattgatcaggcaacgtatgaaaaagcgacg
caggaacgcccgaaagtctataacgatacgctcagtaaaaattccggcccctacattatc
gatgaggttatgcgtcagctcggtgatgcgtttcccgatatccgcagcggcggctacaaa
atctataccacaatcgatatgcggcttcaggaagcgggatataaagcgcttcaatcaggg
cgtgatgagatcttaaaaagggcgcaggaagcgggtgatctggatgaaaatatgcagcgc
cagctcaacggtgcccttatcagtctaaatccccataccggagaggttttggcgatggtc
gggggatatgattactcccttagcccgtacaaccgcgtaactcaggcaaagcgccagccg
ggatcggcatttaagccgtttttgtatcaagtagcactggacagcggtatgtccccctca
tccctcgttcccgatatcgcccgtacctatacctatgcgggtaacgatggcgaagagaaa
acatggcagccgaaaaactacaaaaatgagtacaaagggatggttacgatccgagatgcg
ctgacccattcacgtaaccttgcaacgattaatatggtcagcgatatgggattcggaaaa
attaccgagggactaagacgcttcggtattaccgaaaacctcccgcctgacctatcgatt
gcgctgggaaccatctcgatttctccgatggatttggctaaatattatacgatgttcgcc
agcggcggagcgatgaccaatccgatgctgatccgtgaagtgatcactccgacaggtgaa
aatatcaaataccaaaacaaaagccgccaggttgatacgccgcagcagatctatctgatg
acgtcgatactaaaagacgttgtttctcacggaaccgggacgaatgcacgtgtagcaggg
attgaaatcgccggaaaaacggggacgacgaacgataatgtcgatgcatggtttgccggg
tattctccgacggtagagacgatcgtctggttcgggcacgataataatacgccgatgcgc
cgaagcgagacgggcggacgtgccgcggctccagtattccgttattattacgaagatatg
ctgcggatttatccgaataccaaacgctattttgatgtacctgccggggtttatgtcgga
tcgggaaatgacggaaacaatagcgaatcgtacaccgatacctcggcagtaccggatgcg
actcaggaagaagcaccgaaaaccgacgaaaagttggttttctaa

DBGET integrated database retrieval system