KEGG   Sulfuricurvum kujiense: Sulku_2251Help
Entry
Sulku_2251        CDS       T01370                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
sku  Sulfuricurvum kujiense
Pathway
sku00550  Peptidoglycan biosynthesis
sku01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sku00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulku_2251
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sulku_2251
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
    Sulku_2251
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sku03036]
    Sulku_2251
Enzymes [BR:sku01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sulku_2251
Peptidoglycan biosynthesis and degradation proteins [BR:sku01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Sulku_2251
Chromosome and associated proteins [BR:sku03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Sulku_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADR34911
UniProt: E4TX45
LinkDB All DBs
Position
2272405..2274207
Genome map
AA seq 600 aa AA seqDB search
MRHSNKSKKILALFLLLMFGFVIFLAVMLYTALHKRDIPSIYSEDTAKAQRGSIISADGF
HIATTQKLYKAVVNTRNIDPGKEELFVQLFSIYSGMDPKEIKERLHTRKGSVTLSYHISP
KEAMYLKTLAFELRRLGVFIEYETPNGDRILQGLNILESGEARQYPYGNLLTPLLGYPRK
IEEDGYTRVYGIKGLEKFFDEELNPQQNKTQKALRDVNGYLILNKQSDVKRQINGLTVKL
NIPILLQSRVEIITDQIKQKLQADEIIATVMESKTGKIIALASSNRFDPNHIRVQDYPSL
NANVIEYSYEPGSVIKPIIFSLMLDRGLINPYDMVNGHNGRFTMGTKTIVDEHAFSMLSA
EDVLVYSSNIGIAQLAQKLNGVEFTEGLKRFGFTHFSGIDLPYEKRGSVPSSAQLNNYLY
KAITAYGYGMRANPMQLVKAFNVFNNGGKLINPMVVEALYDDNGRIIPMQIQAPTQVIAP
ATAERMKQILIKTVNVGTGTIAKTPGLEVGGKTGTAHIAKNGAYVNSYHTSFIGFANDSK
HNYTIGITVIEPRTVYFASITAVPVFKAIVDLMVEEKYLTPDPAAAAAASEPSNAESTHL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcgccattccaataaatctaaaaagatacttgccctttttctcctcctgatgttcggt
ttcgtcatctttttggcggtcatgctctacaccgccttgcacaaacgggacatcccctct
atctattccgaagataccgccaaagcacagcggggctccatcattagcgctgacggattt
catatcgccacgacccaaaaattgtataaagcggtcgtcaatacccgcaatatcgatccg
ggtaaagaggagctgttcgttcagcttttcagcatctacagcggcatggatcccaaagag
atcaaagagcgcctccatacccgaaaaggatccgttaccctaagctaccatatcagcccc
aaagaggcgatgtacctaaaaacccttgcattcgaacttcgccgtctcggcgtctttatc
gagtatgaaaccccaaacggagaccgtattttgcaggggctgaacattttagagagcggt
gaagcacggcaatacccctacggcaatctccttactccccttttaggctatccgcgcaaa
atcgaagaggacggatatacccgggtctacgggatcaaagggctggagaagttttttgac
gaggaacttaatcctcagcaaaataaaacccaaaaagcactccgcgatgtcaacggctat
ctgattttgaataaacaaagtgacgtcaagcgccagattaacggcttgaccgtgaaactt
aatattccgattttgcttcaatccagagtggaaatcattaccgaccagatcaaacaaaag
cttcaggccgatgagatcatcgctaccgtcatggagtccaaaacagggaaaattatcgcg
ttggcaagttcgaaccgttttgatccaaaccacattcgggtccaagactacccatcactc
aatgccaatgttatcgaatacagctatgagccgggatccgttatcaaaccgattattttc
tccctaatgctcgatcgcggtctaatcaacccttacgatatggtcaacgggcataacgga
cgttttacgatgggtacgaaaacgattgttgacgaacatgcgtttagtatgctcagtgcc
gaagacgttctggtttattcgtcgaatatcgggattgcccaattggcgcaaaagcttaac
ggtgttgaatttaccgaaggtctgaaacggttcggatttacccatttcagcggcattgac
ctgccgtatgaaaagcggggatccgtcccctcttccgcacaactcaataattatctgtac
aaagcgattaccgcgtacggctacgggatgcgtgccaatcccatgcagttggtaaaagca
ttcaatgtgtttaataacggaggaaaactcatcaacccgatggttgtcgaagccctttat
gacgataacggccgaattattccgatgcagatacaggctcctactcaggttatcgcgcct
gccactgccgagaggatgaagcagattctcatcaaaacggtcaatgtcggaacgggaacg
atcgctaaaacgccgggcttggaagtgggaggaaaaacgggaacggcgcatatcgccaaa
aacggagcttacgtcaacagctaccacacctcgtttatcggatttgccaatgattcaaaa
cataactatacgatcggcatcaccgttattgagccgcgtaccgtctattttgcgtccatt
accgccgtacccgtttttaaagcgatcgttgatttgatggtagaggagaaatatcttact
cccgacccggcggctgcagcggcggcgtcagaaccctcaaatgcggagtctacacacctt
taa

DBGET integrated database retrieval system