KEGG   Serpula lacrymans: SERLADRAFT_349606Help
Entry
SERLADRAFT_349606 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sla  Serpula lacrymans
Pathway
sla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sla00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SERLADRAFT_349606
Enzymes [BR:sla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SERLADRAFT_349606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 18809222
NCBI-ProteinID: XP_007319576
JGI: 349606
UniProt: F8NYZ3
LinkDB All DBs
Position
Unknown
AA seq 172 aa AA seqDB search
MVISRSSLAGSQAIVVLKGDSPVTGSVVFEQSIKDGPVTVSGTISNLDPSSKRGFHVHQA
GDLTNGCLSAASHFNPFGANHGAPTDSERHVGDLGNIESDEFGTAIFSFEDSLISLNGPR
SIIGRGVVVHAGTDDLGRGNNEESLKTGNAGGRAACGVIGMFTCGHYIQEFT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggttatctcaagatcctcattggctggttcccaggcaatcgttgtcttgaagggcgac
tctcccgttactggttcagtcgtcttcgaacagtccatcaaggatggtccagtcacagtt
tctggaacaatttccaacctcgatccttcctcaaaacgtggtttccatgtccatcaagcg
ggcgacctcaccaatggctgcctatccgctgcatctcacttcaacccttttggtgccaac
cacggtgctcccaccgactctgagcgccatgtaggtgacctaggaaatatcgagagcgac
gaatttggcactgccatattctcgtttgaagattcgttgatctcactcaacggtcctcgg
agcattattgggcgtggagtcgtcgttcatgccggtaccgatgatctcggaagaggtaat
aacgaggaatcgctcaagactggtaacgctggtggaagagcagcctgcggtgtcatcggt
atgttcacttgtggtcattacatccaagaattcacataa

DBGET integrated database retrieval system