KEGG   Serpula lacrymans: SERLADRAFT_452596Help
Entry
SERLADRAFT_452596 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
sla  Serpula lacrymans
Pathway
sla03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SERLADRAFT_452596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sla03400]
    SERLADRAFT_452596
Enzymes [BR:sla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SERLADRAFT_452596
DNA repair and recombination proteins [BR:sla03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     SERLADRAFT_452596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT DUF4073
Motif
Other DBs
NCBI-GeneID: 18816845
NCBI-ProteinID: XP_007322465
JGI: 452596
UniProt: F8P7U1
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MMQPTPAPSSLPGSPKGDVNSVEESVTYPAPPQNNGSAPFSVLAGLFERLSTERKPERRR
KLLDAWFNHWREEIGHDLYPVLRLILPQKDRERAVYGLKEKNLAKTYIKLIPLGMRDPDA
IRLLNWKKPTEKDKSSGDFPNVLYEVVNKRSSVIEGSLSITDLNEILDELSKNLGKQDIQ
SKILQRVYNRATPEEQRWIVRIILKDMVISVKETTVFGVLHPDAQDLFNTCSDLKKVAWE
LWDPSRRLKAEDKTIQLFRAFAPMLCKRPTRKIEESVKEMQGRKFIIEEKLDGERIQLHK
RGNEYFYCSRKGKDYTYLYGNHVGTGSLTPFIASAFDDRIEDIILDGEMLVWDPVSERNL
PFGTLKTAALDKTKREHNPRPCFKVFDLLHLNGMSLLQKSLKFRKRNLRACIKEIPGRIE
LAVEFEGKTAKDVREKMDEVMAARGEGLVIKHPDSEYVLNGRNKDWIKVKPEYMDNMGET
VDVLVVGGNYGSGKRSGGVSTLICAVLDDRHSSNDDEELKYSSFVRIGSGLTFADYIWVR
QKPWKLWDPNSPPTFLQTAKRSQDDKGDVYLEPEDSFMLKVKAAEITISDQYHLGFTMRF
PRALSIRDDLSIADCMTATAILENLRTERKRKMESDSSMSKKKKSKTKVAKPSMLPEYQG
LKLNSIEIESNIFEDIKFVVSSDPKSRTGDHDKKELMKMIHANGGSCAQVVTNQQPSMVI
YGGSTTPYDIRLLINKDTVDIIRPQWIVDCVARGEILPLKKKYFFHATFDRQQSADYNQP
DTDEDEDEIMADEEDASLRVPVTPDLKGPKVEEADDIDPSLADWFKVGAKAPEDSATESE
TDADSVNDDVNPDEDEDDWFKVKPEGSLIADKSVITDVPDSSAQPKDEDVSMGADSGMEY
DPNLIFRYLCFYLDSPDNARKHGMTVRAKHEKDVAQSFVDISKMIQENGGQVVDLDDPKL
THIVMDKRDDSRRVELIQRTFKPKRRRLVIAGYIQACLEEETLLDEEEFTP
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagccaacgccagcaccatcgtctcttccaggatctccaaagggcgatgtcaat
tcggtggaggaatcagtcacgtatcccgctccacctcaaaacaacgggagcgctcctttc
tctgttcttgctggtttgttcgagagattatctactgaaagaaaaccggagcgaagaaga
aagttgttggatgcctggttcaaccactggagagaagaaataggccatgacttatatcct
gttctacgcctcattttgcctcagaaggaccgagagcgtgctgtatatggcctcaaagag
aaaaatctggctaaaacatacattaaactaatccctcttggtatgagagatccagatgct
atacgcctgctcaactggaagaagccaactgagaaagataaaagttctggcgacttcccc
aatgtcctttatgaagttgtgaacaaacggtcttcagtcatcgaaggctctctttcaatc
actgacctcaatgaaatactcgatgagctgtctaaaaatctaggcaaacaggacatccag
tcaaagatattgcaacgagtatacaacagagcaactcccgaagaacaacgttggatagta
agaatcatcctaaaagacatggtgatatccgtcaaagaaacaactgtttttggggttttg
catccagatgctcaggacctattcaacacttgttcagaccttaagaaggttgcctgggaa
ctatgggatccctctcgcagacttaaagccgaggataaaactatacaattattccgtgcc
ttcgcaccgatgttatgtaaaaggccaacgcgcaagattgaagagtctgtgaaagagatg
caaggtcgtaagttcattattgaagaaaaacttgatggagagcgcatacaattacacaag
cgcggaaatgaatatttctactgttcaagaaaaggaaaggattatacctacctgtatggc
aatcacgtcgggacgggtagcctgacgccttttattgcttcggctttcgacgaccggata
gaagatataattctcgacggcgaaatgctggtatgggatcccgtttcagagcgcaatctt
cctttcggtactctcaaaacagcagccctcgacaaaactaagagggaacataatccccgg
ccatgcttcaaagtattcgatctccttcatttaaatggcatgtcacttctccagaaatct
ctcaagttccgcaaacgcaatcttcgtgcatgtattaaagaaatccctggtcgcattgag
ttagccgtagaatttgagggtaagactgcgaaggatgtcagagagaaaatggatgaagta
atggcagcaaggggggaaggtttggtcatcaagcatccagattctgaatatgtcctaaac
ggtagaaataaagattggatcaaggttaaaccggagtatatggacaatatgggcgagact
gttgatgtgttggttgtcggtggtaactacggaagtggaaaacgttctggtggtgtttct
actctcatatgtgctgttctcgacgaccggcattcttccaacgacgacgaagagctcaaa
tatagtagttttgttcgcatagggtctggcttgacctttgcagattatatctgggtgcgc
cagaaaccctggaagctttgggatcccaattctccccctaccttcctgcagactgcgaaa
cggtcacaggatgacaagggtgacgtatatcttgaaccagaggattcatttatgctgaag
gttaaggccgctgaaatcacaatatcagatcagtaccatctgggtttcacaatgcgcttc
cctcgtgcgctttctatccgcgacgatctttctatcgcagattgcatgacagcaactgct
atcctggaaaatttacgaactgagagaaagagaaaaatggagagcgactccagtatgagc
aagaagaagaaaagcaaaacgaaagttgcaaagccttccatgctcccagaatatcaaggg
ctcaagctcaattcaattgaaatcgagtcaaatatatttgaagatatcaagtttgtggta
tcttcggatccgaaatcgaggacaggagaccatgacaaaaaggagctgatgaagatgatt
catgccaatggtggtagctgcgctcaagtagttactaatcaacagccaagcatggtgatt
tacggtggttcgacaacaccatacgatattagacttttgatcaacaaagacactgttgac
attatccggccacaatggatcgtagactgcgttgctcgcggggagattctcccgctcaag
aagaagtattttttccacgcaacgttcgatcgccaacaatctgcggattacaaccagccc
gatactgatgaagacgaggatgaaattatggccgatgaagaggatgctagtttacgtgtt
cccgtgacccctgatctgaaggggcccaaggtagaggaagctgacgacatagatccctca
ttggcagactggtttaaagtcggagcaaaagcgcctgaagatagcgccaccgaatcagaa
acggatgccgactccgtgaatgacgatgtgaatcctgatgaggatgaggacgactggttt
aaagttaaacctgaaggaagtctcattgcagacaagagcgttataacagatgtgccggac
tcaagcgctcaacccaaggatgaagatgtttcaatgggggcagattccggtatggaatac
gaccccaatttaatctttagatacctatgcttctacctcgattcaccggacaacgctcgc
aaacacggaatgacggtgcgagcgaagcatgaaaaggatgtcgctcagagtttcgtcgac
atctcgaagatgattcaagaaaatggcggacaagtggtggaccttgacgaccccaagctc
acacatatagtaatggataagcgggatgattcccgtcgtgtagagcttattcagcgcacg
ttcaagccaaaacgacgtcggttggttatagctgggtacatccaagcctgcctagaggaa
gaaactttgttggacgaagaagagttcactccataa

DBGET integrated database retrieval system