KEGG   Serpula lacrymans: SERLADRAFT_453109Help
Entry
SERLADRAFT_453109 CDS       T03135                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sla  Serpula lacrymans
Pathway
sla00052  Galactose metabolism
sla00500  Starch and sucrose metabolism
sla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SERLADRAFT_453109
   00500 Starch and sucrose metabolism
    SERLADRAFT_453109
Enzymes [BR:sla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SERLADRAFT_453109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18816897
NCBI-ProteinID: XP_007323211
JGI: 453109
UniProt: F8PAD7
LinkDB All DBs
Position
Unknown
AA seq 968 aa AA seqDB search
MARFALWTGLHLFACPLLAAARDPSILQRGLATNGLLASSGSYSGNVANCPGYTLGSLVE
SDTGLTAQLALAGTACNAFGQDIQNLTIQVTYETESRLHVNIFDTSNLQFTIPSSVISRP
DPPSTSYVNSSDLVFNYDASPFAFWITRRSLPDAFPLFDTRQSSLPATPIPPFMPGDNST
ALDGFPLVFEDQYLQLTSSLPYGTNIYGLGEVIASSGFRRDIGTGGGVGTLQTMWDRDDP
DPIDENMYGSHPIYLEHRYNETTGKSSSHGVMLFSSSGADILLSTPQSEKNVSLIEYRLV
GGVLDFYFFAGPSPTEVIAQYSAVTGLANWQPAWGFGFHLCRWGYHNISITRDQVLRMRE
ANIPLETQWNDIDLYHAYRDFTSDPVSFPGDEMREFIEELASNNQHYIPIVDAGVAILNN
ATDVYYPYSRGSELDVFVKNPDGSEYIGQVWPGYTVFGDWFANNTQQWWSEALRNWSNYG
IEFSGIWLDMNEVSSFCNGSCGTGANTADTGVPIEIPGQPGNLVTGYPECYNSTLSGPSG
NMTINGTLTYACGIAGAEGALAKRGIGAGEETGVNLNDPPYAIHNSFGPLWVKTLATNAT
HAGGYVELDVHNMWGMMEEKATHAAVSEIRAGERPFLISRSTFPSSGRWSGHWLGDNFSK
WQYMYYNIQGVLQFQIYQIPFVGADTCGFQDNTDEELCNRWMQMSAFVPFYRNHNTLGAL
SQEPYRWPSVANASRIAIAARYSMLPYWLTLFANVSTIGTPPVRALFYEFPDEPELFEVD
RQFMVGPDILVTPVLTPNATTVDGIFPGRGTVVWRDWWTHDVVNATVGGNTTLSAPLSHI
NVHIRDHSALLLHAEPAYTIAETRAGPYALLISLDTAGTAFGNAYVDDGISSPPGPSTVL
TFTVANGELNVKSEGAWAIEQMLEEITPTEVTLGGAPVEGWTYDEGQEGLTFSNISVDLN
ESSMLAWK
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttttgcgctctggacaggcttacatctgttcgcatgtccactgcttgcagca
gcacgcgacccatccatcctccaacgcggtctcgctacaaatggcctactcgcctcaagc
ggttcctactccgggaacgtagcaaactgcccagggtacacgctcgggtcacttgttgag
tctgacacgggcctcacagctcagctcgccctcgcaggtaccgcttgtaatgcgttcgga
caggacatccaaaatctcactattcaagtgacctatgaaactgagtctagacttcatgtc
aacatcttcgacacttccaacctccagttcactatcccatcctccgtcatctcccgccca
gaccctccttccacttcctatgtcaacagttcagacctggtgtttaattacgacgcttcg
ccatttgcattttggataacccgtcgttctctccccgatgcattccccctcttcgacact
cgtcaatcatccctgcctgccacgcctattcccccattcatgccgggtgacaatagcact
gcactggatgggttcccactggtgttcgaggaccaatacctccagctaacttcctccctc
ccatatggcaccaacatctacggtctcggcgaagtgatcgcctccagcggattcagacgc
gacattggcacaggtggcggcgtcgggaccctccaaaccatgtgggacagagatgaccca
gaccctatcgacgaaaacatgtacggctcacatcccatctacctcgagcaccgctacaat
gaaaccaccggaaagtcgtcctcgcacggggtgatgctcttcagctcttccggtgccgac
atcctcctctcgaccccgcagtcagagaagaatgtgtcattgatcgagtatagactggtg
ggaggggtacttgatttttatttctttgcaggaccgagtccgacggaggtgatcgcgcag
tattcggctgtgacgggtcttgcgaattggcaacctgcgtggggtttcgggtttcatcta
tgtcgatggggttatcacaacatcagtatcacacgagaccaggtgctaaggatgagagaa
gccaatattccactcgagacccaatggaacgacatcgacctttaccacgcttatcgtgac
tttacttccgaccctgtcagtttcccaggggacgagatgagggagtttattgaggaactc
gcgtcgaataaccagcactatattcctatagtagatgcgggcgtggcgattttgaataat
gcaacagacgtttattatccctactcccgaggctccgaactggatgtgttcgtcaagaac
ccggacgggtcggagtatattgggcaggtgtggcctgggtatacggtctttggagattgg
ttcgcgaacaacacccagcagtggtggtccgaggcacttcgcaactggagcaactatgga
attgaattctcggggatatggcttgatatgaacgaggttagctcgttttgtaatggttct
tgcgggacgggcgcgaacacagcagacactggcgtacctattgaaatcccaggacagcct
ggtaatctcgtcactggttatcctgagtgctacaactccacgctctcaggcccgagtggt
aacatgactattaacgggacattgacgtatgcctgtggtatagctggtgccgaaggtgct
cttgccaagcgtgggattggcgctggtgaggaaacaggtgtgaacctcaacgacccgccc
tacgcaattcacaacagctttggccccttgtgggtgaagactctcgctacaaacgcgacg
catgcgggtggctatgttgagcttgacgtgcataatatgtgggggatgatggaggagaag
gcgacgcatgcagctgtgtcggagatccgtgctggggaacgaccattcttgatctcgcgc
tcgacgttcccatcgtctgggcggtggtcgggccattggctcggagacaattttagcaag
tggcaatatatgtactataacatccagggtgtcctgcagttccagatctaccaaatcccg
tttgtaggcgcagatacttgtggattccaggataacacagacgaagaactctgcaaccga
tggatgcagatgtcagcgtttgtgccattctatagaaaccataatacgcttggagcgtta
tcgcaggagccttaccgctggcctagcgtggcaaatgcatcccgaattgctattgcggca
cgttactcgatgttaccatactggttgacgctgttcgccaacgtatccacgatcgggact
ccacccgtcagagccctgttctatgaattccctgacgagccggagctctttgaggtggac
aggcagttcatggtaggccctgatattcttgtcacccccgtcttgacacccaatgctact
acagtggatggaatcttccctggccgtggaactgtcgtgtggagagactggtggacgcat
gatgtggtgaacgcgactgtgggcgggaacaccactctctctgcaccgctgagtcacatc
aatgtccacatccgcgaccactcagccctcctcctccacgccgagcctgcttacacgatc
gcagaaacgcgcgcaggcccctatgcgctcctcatttcacttgacaccgctggcaccgcg
ttcggaaacgcctacgttgacgatggtatcagctcgccgcctggtccaagcacagtcttg
acgttcacggttgcaaatggagagctgaatgtgaagagtgagggtgcgtgggcgattgag
cagatgttagaggagattactccgacggaggtgacgttgggtggggcacctgttgaaggg
tggacgtatgacgagggccaggaaggattgactttttctaatattagcgtggatttgaat
gagagttcgatgttggcgtggaagtga

DBGET integrated database retrieval system