KEGG   Serpula lacrymans: SERLADRAFT_453724Help
Entry
SERLADRAFT_453724 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
sla  Serpula lacrymans
Brite
KEGG Orthology (KO) [BR:sla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sla03036]
    SERLADRAFT_453724
Enzymes [BR:sla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SERLADRAFT_453724
Chromosome and associated proteins [BR:sla03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SERLADRAFT_453724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18816954
NCBI-ProteinID: XP_007323948
JGI: 453724
UniProt: F8PC27
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MHPTTGLADPDNTHVQSEQEPTMGGHQSEDNKINQSERKASIVIQDECLQHRFIRSRDSS
SIVERPERIRAVKVGVAAAIARLEEIQDTHGGISPTPAKVTQATSDPDDLIAALGRMNLA
ADPAQPRIPSLSILKSHATVNLLDDPATKFIHGDVDGDVYLQNLKNWAKESQDNILKNGS
EIPSNLPQLDLYLSPGSIDAIQGAVGAVCEAVDTVINSTRQHIDVKDHAHRVFVAIRPPG
HHCGEDTPCGFCFVNNVAVGAAHAHLKHGIRRILIFDIDLHHGNGTQSIIWQINEETYRQ
TLESEYAPSDTSPKTGPQIYYGSIHDILSFPCEDGNMQCVQAASTCLHGPHGQHIENIHI
QAYESNDQFWELYRTQYTKIFTRAEEFLDKTGGPGDDVLVLLSSGFDACEHEGGSMSRHK
RNVPASFYYRFTRDACAFADRYAQGRIVSVLEGGYSDRALISGAMAHMCGLVDIQTPGAV
VDEEWWSAENLDKLEKATKKRKGGRQSAANSPEPWLDRALSVFTTLEAGASQNMTPSSSR
NTFIPPTSMTLRDRRKPSSKLAETQSSATSSSGSPTLPQSKRGDKDGSEKTNNLQLPPST
SSSSSDITDSSSDVAPNSTGLPISAVEEVIVPAKKLPRVILKVGPPPSMS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccacaacaggtctggcagatccagacaacacacacgtacaatccgaacaggaa
ccgactatgggtggacaccaatctgaggataacaagattaatcagtctgaacggaaagcg
tcaatagttatacaagatgaatgtcttcagcatcgtttcatccgttcacgagactcatca
agtatcgtcgaacggccagagcgcatacgggctgtcaaagttggtgtagccgcagccata
gcccgtcttgaggaaatacaagacacacatggcggtattagtcctactcctgcgaaagtc
acccaggctacatcagatcctgacgatctgatagctgcacttggtcgtatgaaccttgct
gcagaccctgcccaacctcgtataccgtccctatctattctaaaaagtcacgctacagta
aatctgctagacgacccggcgacaaaatttattcacggcgatgttgatggagacgtttat
ttgcaaaacttgaagaattgggctaaggaaagccaagataatatcttaaagaacgggtct
gaaattccctcaaatttacctcaacttgacttgtatttatctcctggttccattgatgct
attcaaggcgctgtgggagccgtctgcgaagctgttgacaccgttataaattccactcgc
cagcatatagacgtcaaagatcacgcccatcgcgttttcgtggccatcaggcctccagga
caccactgtggtgaagatacaccttgtggcttttgtttcgtcaacaatgttgctgtcggt
gctgcacatgcacatttgaagcatggcattcggcgtatcctcatatttgacatagattta
catcatggaaatggcactcaatctattatctggcagatcaatgaagaaacatatcgacaa
acactagagtctgaatatgctccatcagacacatcgcctaaaactggtcctcagatttat
tatggttcaatccatgacatcttgtcatttccttgtgaagacgggaatatgcaatgtgta
caagccgcatcgacatgtctacatggtcctcatggacaacatatcgagaatatccatata
caggcttatgagtcgaatgatcagttttgggagttatatcgaacccaatacaccaaaata
ttcactagggctgaagaattccttgacaagactggcggacccggtgatgacgtccttgtt
ctcctaagctctggattcgatgcatgtgaacatgagggcggatctatgtcaagacacaaa
cgaaatgtgcctgcctctttttactaccgctttacccgtgacgcgtgtgctttcgccgac
cgctatgctcaaggcaggattgttagcgttctagagggtgggtacagtgaccgtgccttg
ataagtggtgcgatggcccatatgtgtggattggtcgacatacaaactccaggagctgta
gttgacgaggagtggtggagtgcagagaatttggacaagctggaaaaagcgacgaagaaa
cgaaaagggggccgacaatcagcggcgaattctccagagccatggctggatcgtgcccta
tcggtctttacaactctagaagccggtgcttctcaaaacatgacgccgtcgtcttcccga
aacactttcattcctcctacatctatgacattacgggacagaagaaaaccttcatctaaa
ctcgcagaaactcagtctagcgctacttcaagctcaggttcaccaacgttgccccaatct
aagcgcggagacaaagatggaagcgagaagacaaataatttgcaactgccaccatcaact
tcatcatcttcgtccgacatcacggacagttcaagtgacgtagcccctaactccacaggg
cttccaatctccgctgttgaagaagtcatagttccggcgaagaagcttccaagagttatc
ttgaaggtcggccctcccccttctatgtcatag

DBGET integrated database retrieval system