KEGG   Serpula lacrymans: SERLADRAFT_461886Help
Entry
SERLADRAFT_461886 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
sla  Serpula lacrymans
Pathway
sla00040  Pentose and glucuronate interconversions
sla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SERLADRAFT_461886
Enzymes [BR:sla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     SERLADRAFT_461886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 AlaDh_PNT_C PrmA UDPG_MGDP_dh_N Methyltransf_31 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 18818291
NCBI-ProteinID: XP_007315897
JGI: 461886
UniProt: F8NM18
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MSDNPSFVLLGIDNVTFEQRPIVEPAADEVLVQVKKTGICGSDVHFYVHGRIGDFIVEKP
MVLGHESAGVIAKVGSGVTTLKVGDRVAIEPGATCRKCEYCKTARYQLCPDVVFAATPPN
DGTLGRYYRVPADLAYPLPDHLSLEDGAMMEPLSVGIHAVAKLGEFQANQSIAVFGCGPV
GILCMAVAKALGASRIIAVDIAPSRLEFAKSYAATDVFVPPAPEKDESRVAFSKRSAAAM
QKALGIADRGPQAIDLVIDASGAEVSIQTGIRIAKTGGAFVQVGMGSPDVTIDMSVLITK
ELKMRGSFRYGPGDYKLAIALVAQGKIDLKPLVTHRFPFESALQAFKTTRQGKSDDGKGV
IKAIISGPDVPLDSA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataatccgtctttcgtgttactcggtatcgataacgtgacctttgagcagaga
ccaatcgtcgaaccggctgcagacgaggtcctcgtgcaggtaaagaagactggaatctgc
ggatcggatgtccatttttatgtccacggccgtattggagatttcatcgttgagaaaccc
atggtcctaggccatgagtctgcaggtgtcatcgcaaaagttgggtccggcgttacaaca
ctcaaagtgggcgaccgggtagccatagagccaggtgctacttgtcgcaagtgcgaatac
tgtaagactgctcgctaccaactttgtccagatgtcgtttttgccgccactccgccaaac
gatggcactcttggtcgctattatcgtgttcctgctgatctagcttatccgttacctgac
caccttagtcttgaagatggagctatgatggagcccctgtccgtgggaatccatgcagtt
gctaagctaggcgaattccaagcaaatcaatccattgcagtttttggatgcggacccgtt
ggtattctgtgcatggctgttgctaaagctctcggtgcctcccgcataatcgccgttgat
attgcgccgtctcgtctcgagtttgcgaagtcgtatgcggcgaccgacgtgttcgtgccc
cctgctccagaaaaggatgaatctcgcgtagctttctcgaagaggtcggcggcagcgatg
cagaaggcacttggcattgcagacagaggtcctcaagcaattgatcttgtcattgatgcc
agcggtgccgaggtgtctatccaaacgggaattcgcatcgcaaagacggggggtgccttt
gttcaggttgggatggggagccctgatgtcacaattgacatgagtgtcttgatcacaaaa
gaactgaagatgaggggttcattcagatacgggcctggtgactataagctggccattgct
ctcgtggcgcagggaaagattgacctcaaacctcttgtgactcatcgcttcccattcgaa
agtgctctccaggcattcaagacgactcgtcaaggaaagagtgacgatggtaaaggtgtc
atcaaagccatcatatccggccccgatgttcccctcgactcggcgtga

DBGET integrated database retrieval system