KEGG   Serpula lacrymans: SERLADRAFT_463437Help
Entry
SERLADRAFT_463437 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sla  Serpula lacrymans
Pathway
sla00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SERLADRAFT_463437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sla02000]
    SERLADRAFT_463437
Enzymes [BR:sla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SERLADRAFT_463437
Transporters [BR:sla02000]
 Other Transporters
  Pores ion channels [TC:1]
   SERLADRAFT_463437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_5 GST_N_4
Motif
Other DBs
NCBI-GeneID: 18818555
NCBI-ProteinID: XP_007316576
JGI: 463437
UniProt: F8NS94
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MGIPDEKIHPVATGVAIKTVEKHQEPQELVFYSGWFCPFNQRTWISLEEKGIPYQYKEVN
PYKKEKHFLDINPKGLVPAIEYRGKALYESIILCEFLEDAYPSHKPHLLPVDPFDRAHAR
IWIDHCTKTIVSATHRLLQSQDKESQDNAREELYAAQRKLAKEVKGPYFNGEEFGLVDIC
VAPWIARDYVVAEHRGYKREDASKEWKEYADRLSQRESVVKTMSEREHLNVIYDRYLRDE
AQSEAAKATRAGREIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcctgacgaaaaaatccatccagttgcgactggagttgctatcaagaccgtc
gagaaacatcaagaacctcaggagctagtattttactcaggatggttctgtccattcaac
cagcgaacatggatatctctcgaagagaagggcatcccttatcaatacaaggaagtgaat
ccttacaagaaagaaaaacatttccttgatatcaaccctaaaggattagtcccagccatt
gaatacagagggaaggctttatacgagtcgatcatcctttgcgagtttctggaggacgcc
taccctagccacaagcctcaccttctcccggttgacccatttgatcgcgctcatgcgcgc
atttggattgaccattgcacgaaaactatagtctcagcaacacaccgtcttctccaatcc
caggacaaggagagccaggacaacgcccgtgaggagctgtacgcagcgcaaagaaaactt
gctaaagaggtcaaaggcccctattttaatggtgaagagtttggcctggtggatatatgc
gttgcgccttggattgcgcgcgactatgttgtcgcagagcaccgtggatacaaaagggaa
gatgcgagcaaagaatggaaggaatacgctgataggctctcacaacgtgaaagtgtggta
aagactatgagtgaaagggagcacttgaatgtcatttacgaccgctaccttcgagatgaa
gctcaaagcgaagctgccaaggccacgagagcgggaagagaaattccttga

DBGET integrated database retrieval system