KEGG   Serpula lacrymans: SERLADRAFT_464226Help
Entry
SERLADRAFT_464226 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sla  Serpula lacrymans
Pathway
sla00010  Glycolysis / Gluconeogenesis
sla00051  Fructose and mannose metabolism
sla00052  Galactose metabolism
sla00500  Starch and sucrose metabolism
sla00520  Amino sugar and nucleotide sugar metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
sla01130  Biosynthesis of antibiotics
sla01200  Carbon metabolism
Module
sla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERLADRAFT_464226
   00051 Fructose and mannose metabolism
    SERLADRAFT_464226
   00052 Galactose metabolism
    SERLADRAFT_464226
   00500 Starch and sucrose metabolism
    SERLADRAFT_464226
   00520 Amino sugar and nucleotide sugar metabolism
    SERLADRAFT_464226
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SERLADRAFT_464226
Enzymes [BR:sla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SERLADRAFT_464226
Membrane trafficking [BR:sla04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SERLADRAFT_464226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18818707
NCBI-ProteinID: XP_007316963
JGI: 464226
UniProt: F8NRJ7
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MPASRRGSGSVTLPTGQTLAIHTRIQGEEDLPHATKKTMADHLRKYESLFTLTPQRMRMI
VEAFTETLEIGLNKPNQIVPMIPTYVFGWPTGQETGDFLALDLGGTNLRVCLVTLQGEGK
FEITQTKYRLTEEQKQDDGQKLFDFCAECLKTFVDTNFGERDSALKPGQNLPLGFTFSYP
CSQERIDHGELIRWTKGFGAANTEGRDVAEMFKKSLEKYQLPIQLTALINDTTGTLIASH
YVNPRTKIAVIFGTGCNAAYMENVKNIEKINHLGIDPAAEMAINCEWGAFDSFEHEHLPR
TKYDAIVDDTSNKPGEQAFEKLISGRYLGEILRLVICELIDEGVLFLGQNTYKLEKPYCL
DTAFLSLMESDPTDELLMIIGIFTHFFALETTLAERQFFRALAKLIGRRAARLSSCGIAA
IVSKMGYLEEGCMVGADGSLYNKYPGFADRVHEGLQDIFGEKGRNIITHHAEDGSGVGSA
IIASYDKDQERRWIVHSCLNYRQDEGHCDSAKNRQIAM
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgccagcatctcgtcgtggtagcggcagcgtcacattgcctactgggcaaacgcttgcg
atacatactcgtattcaaggcgaagaggatttgccccatgcaaccaagaagaccatggcc
gatcacctcaggaagtatgaaagcctattcacgttgacgccgcaaagaatgcggatgatt
gtcgaggccttcacagaaacgttggagatcggcttgaacaagcctaatcagattgtgcct
atgattcctacctatgtttttggttggccaacgggacaagaaactggtgactttctagcc
ctggaccttggcggtaccaatcttcgtgtatgtcttgtaactttgcaaggcgaagggaaa
ttcgagattactcaaacgaaatatcgactgacggaagaacaaaaacaagacgacgggcag
aagctattcgatttctgtgcagaatgtttgaagactttcgtcgacacaaattttggcgaa
cgtgacagtgcgctaaagccgggacagaaccttccacttgggtttactttttcataccct
tgctcgcaagagagaattgaccatggtgaactcatccgatggacaaagggctttggtgct
gccaacactgaaggcagagacgtggcagaaatgttcaagaagtcgctggaaaaataccaa
ctccccatacaactgactgcactcatcaatgatactacgggaacgttaatagcatctcat
tatgtaaaccctagaacgaagattgctgtcatttttggcaccggatgtaatgctgcctac
atggaaaatgtgaaaaatatcgagaaaatcaaccacctcggtatcgatcccgccgcggaa
atggcgatcaactgtgaatggggtgctttcgattctttcgaacacgagcacctaccccgg
actaaatatgatgccattgttgatgatacttcaaataaacccggagagcaagcattcgaa
aaactcatatctggtcgttatttgggtgaaatcttgaggctggtgatatgcgagctgata
gatgaaggtgtcctcttccttggacaaaacacctataaactagagaagccttactgtctt
gacacagcgttcctttcgcttatggagagtgatccgaccgatgagctcctcatgatcatc
gggatttttacacacttcttcgctcttgagacaacattagcagaacgccagttcttccgt
gctctcgcgaagctcatcggaaggcgtgccgcacgactgagctcctgtggtatcgcagcg
atcgtcagtaaaatgggttacttggaagaaggatgtatggttggtgccgacggctcattg
tacaacaaataccctggatttgcggatagggtacatgaaggtctgcaggacatttttgga
gagaagggacggaacattataacgcaccacgccgaggacggaagtggtgtcggaagcgct
ataatagcaagctatgacaaagatcaggaaagacgctggattgtacattcatgtttgaac
tatagacaggatgaaggtcattgtgactcagcgaagaatagacaaatagctatgtaa

DBGET integrated database retrieval system