KEGG   Serpula lacrymans: SERLADRAFT_467880Help
Entry
SERLADRAFT_467880 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
sla  Serpula lacrymans
Pathway
sla03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SERLADRAFT_467880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sla03400]
    SERLADRAFT_467880
DNA repair and recombination proteins [BR:sla03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SERLADRAFT_467880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I XPG_I_2 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 18819308
NCBI-ProteinID: XP_007318506
JGI: 467880
UniProt: F8NX12
LinkDB All DBs
Position
Unknown
AA seq 413 aa AA seqDB search
MRDSEDITQQMISQIMLLLRLFGIPYITAPMEAEAQCAELVSLGLVDGIITDDSDVFLFG
GQRVFKNMFNQSKTVECFLLSDLGRELGLERGTLIRLAYLLGSDYVEGLSGVGPVVAMEL
LKEFPGEDGLHKFKDWWLKVQSGRDKDEENKSKFRKRFKKKYKDLYLPQEWPNAAVRDAY
YHPTVDSSEEPFKWGLPDLDALRDFLREELGWGQSKVDDLLLPIIQKMNKRKQATSLNRQ
GNLNNFLDVAPGSHAPRKRQAYASKRLQQVVSEFRSEQAKLKGKQPTSEEDKSESDVAED
VPPKKKRKTGVQGTRRKGGTKTAVDNSKEKKSTVSRKRGRGGRAGTTSGSRKNDTGSVIP
SKGSESADEYKGDSGHEADRRAPSLAVQLRPRARPIPKGSQHIVSNAYESDGT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactctgaggacatcactcaacagatgatatctcagatcatgctcctactacga
ttatttggtatcccatatatcaccgcaccaatggaagccgaagcccagtgcgccgagttg
gtgtcgctaggattagtggatggtatcatcacggatgactcggatgtatttctcttcggc
ggccagcgtgtcttcaagaatatgttcaatcagtctaagactgtggagtgttttcttcta
tctgatcttgggcgtgaacttgggctagagcgtggaacactgattaggctggcatacctg
ctagggagtgattacgttgagggtctatctggagtggggccggtcgtggcaatggagctg
ctgaaagaatttccgggcgaggacgggcttcataaattcaaagattggtggctgaaggta
cagagcggtcgggacaaggatgaagaaaacaagtccaagttccgaaaacgttttaagaaa
aaatacaaggatctatacctaccacaagagtggcccaatgcagcagtgcgggatgcctac
tatcaccctacggtagattcatcggaagaaccattcaagtggggcctacccgaccttgat
gctctacgcgatttccttcgtgaggagctaggatggggtcaatccaaagttgacgatctt
cttctaccgattattcaaaagatgaacaaacgaaagcaggctacatccttgaatagacaa
ggcaaccttaataactttctagatgtagcgccgggatcacatgcaccgcggaaacgtcag
gcgtatgcaagcaaacggttgcagcaggtcgtctcagagttccgcagtgaacaagccaaa
cttaaagggaaacagccgacgtctgaagaagataaatcagaatccgacgtcgcggaggac
gtaccccctaagaaaaaaagaaagacaggggtacaaggaacaagaagaaaaggtgggacc
aaaacggccgtagataattctaaggagaagaaatctactgtcagtcgtaagaggggtcgc
ggaggacgagcaggcacgacttctggaagtcgaaagaatgacactggatctgtaattcct
tcaaaagggagtgagagtgcagacgagtacaagggtgacagcggccacgaggcagatagg
agggcaccttctctcgcggtccagcttcgaccgcgagcgagaccgataccgaaggggagc
caacatattgtatcaaatgcgtacgaatcggatggaacatga

DBGET integrated database retrieval system