KEGG   Serpula lacrymans: SERLADRAFT_470786Help
Entry
SERLADRAFT_470786 CDS       T03135                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
sla  Serpula lacrymans
Pathway
sla00500  Starch and sucrose metabolism
sla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SERLADRAFT_470786
Enzymes [BR:sla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SERLADRAFT_470786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18819822
NCBI-ProteinID: XP_007319841
JGI: 470786
UniProt: F8NZV8
LinkDB All DBs
Position
Unknown
AA seq 572 aa AA seqDB search
MRRFVLSALALCVSVVAQSSTVDSYISTESPIAQAGLLANIGPDGSKSSGAYPGVVIASP
STTNPDYLYTWVRDSSLVFKTLIDQFTAGNDASLRTLIDDFTTAEAAIQQITNPSGSVST
GGLGEPKFNINETAFTGAWGRPQRDGPALRSTALITYANWLLANNNASYVSNTLWPIIKL
DLDYVSNNWNQSTFDLWEEIDSSSFFTTAVQHMSLRQGSTLATAIGQTSVVSGYNTQADN
LLCFLQSYWNPTGGYITANTGGGRSGIDANTVLASIHTFDVDAGCDAATFQPCSDVALSN
LKVYVDSFRSIYSINSGIASDAAVATGRYPEDVYQGGNPWYLTTFAVAEQLYDSLTAWSK
AGSLNVTSTSLAFFQQFSSGVTAGSYASSTSTYSTLTTAIKNFADGFIAVDATYTPSGGA
LAEQYGRSNGTPVSAVDLTWSYASALTVFAARAGNVSASWGAAGLAVPATCSGNSGPTVA
VTFNVDATTVEGENIYVSGSVGALGNWDTSSAIAMSAANYPTWSVTVNVTASSNIQYKYI
RIQNGAVTWESDPNNSITTPASGTYTTNDTWR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgttttgtgctttctgctcttgcgctctgcgtgtcggttgttgcccagtcgagc
accgtagactcgtacatcagcacagagtcgcccatcgctcaggctggtctcctcgcgaat
atcggtcctgatgggtccaagtcatctggagcatatccaggagttgtaatagccagtcca
agcacgaccaatcctgactatctctatacatgggtccgcgactcgtcccttgtctttaaa
actctcatcgaccagttcaccgctggtaacgacgcgtccttgaggactctcatcgatgat
ttcaccactgcagaggctgcaattcagcagattacgaaccccagtggctcagtttctacc
ggtggtcttggagaaccaaagttcaatatcaacgaaacagcctttacaggtgcttggggt
cgccctcagcgtgatgggcccgcattgcgctcgacggccttgattacctacgcgaactgg
ctgttggcgaacaacaacgcttcctacgtatcaaacacgctttggcctatcatcaaactt
gacttggactatgtttccaacaactggaaccagtcaacgttcgacctttgggaagaaatc
gactcttcttcattcttcaccaccgccgtccagcatatgtcattgcgccaaggttctact
ctcgcaaccgccattggccagacgtctgttgttagcggctacaacacacaggccgacaac
cttctctgtttcctacagtcgtactggaacccgaccggcggttacataacggccaacact
ggcggaggtcgatctggtatagatgctaacacagtgctggcttctatccacaccttcgat
gttgacgcaggatgtgatgccgccacattccaaccttgttcagatgtggctttgtccaat
ctcaaagtctatgtcgactctttcagatctatctactccatcaacagtggaattgcttct
gacgcggctgttgcaactggaaggtatcctgaggatgtttaccaaggtggaaatccttgg
tacttgactacattcgcggttgccgaacaactctacgactcccttactgcctggtcgaaa
gccggttccctcaacgttaccagcacctccctcgccttcttccagcagttctcttctggc
gtcactgccggctcctatgcttcatctacttccacttatagcacccttaccactgccatc
aagaacttcgctgatggcttcattgctgtggatgccacatatacaccttctggtggagca
ttggctgaacagtacggcagatccaatggaacgcctgtcagtgccgtcgacctgacatgg
agctatgcttctgcgttaaccgtattcgccgccagagctggaaacgtatcagccagctgg
ggagctgcagggttggctgttccagcgacgtgcagtggtaacagcggtcccactgtcgca
gtgacgttcaatgtagatgctacaacggttgaaggagaaaatatatacgtgtctggatcg
gtaggggcacttggtaactgggataccagcagcgctatcgcaatgtctgctgctaactac
ccaacgtggagtgttaccgtcaatgttactgctagctccaatatccagtacaagtacata
cggatccaaaacggggctgtgacatgggagtcggacccgaacaactcgattaccactcct
gccagcggtacatacaccacaaatgacacctggcgttga

DBGET integrated database retrieval system