KEGG   Serpula lacrymans: SERLADRAFT_475471Help
Entry
SERLADRAFT_475471 CDS       T03135                                 

Gene name
SDH1
Definition
(RefSeq) minor succinate dehydrogenase isozyme, Sdh1p
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sla  Serpula lacrymans
Pathway
sla00020  Citrate cycle (TCA cycle)
sla00190  Oxidative phosphorylation
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
sla01130  Biosynthesis of antibiotics
sla01200  Carbon metabolism
Module
sla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sla_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SERLADRAFT_475471 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SERLADRAFT_475471 (SDH1)
Enzymes [BR:sla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SERLADRAFT_475471 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18820647
NCBI-ProteinID: XP_007321927
JGI: 475471
UniProt: F8P6A3
LinkDB All DBs
Position
Unknown
AA seq 644 aa AA seqDB search
MFKKSVSTAAASRALLRSQRTFSTTSAARKVVATNPVKAEEVKSWSSGKYPLIEHEYDAI
VVGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYD
TVKGSDWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKYGKGGQ
AYRCAAAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLH
RFRSHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGC
LITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPDKDHLY
LQLSHLPPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTTD
KDGKDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKDTLTPGKPHKAI
PEEAGMGSVEFLDQVRNADGSEPTAKIRLDMQKAMQSDAAVFRTQESLDEGVQKMRSIYK
SFDNVGIKDRSMIWNSDLVETLELRNILQCAIQTITAAAARKESRGAHAREDFPERDDDK
WMKHTLTLQRDINEPDVEITYRGVIGTTLDESECKAVPPFKRVY
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagtctgtgtcgacggctgcagcctcaagggcgttgcttcgctcacaacga
accttttcgaccacgtctgcagccaggaaagttgtcgcgacgaaccctgtaaaagctgag
gaagtcaagtcctggtcttcaggaaagtatcccttgattgaacacgaatatgatgcaatt
gtcgttggtgctggtggtgctggattgagagcagcatttggtctagcagaggcaggtttt
aatacagcgtgtatcaccaagttgttccccactcgcagtcatacggtcgccgctcagggt
ggtatcaatgccgctcttggtaacatgactgaagacgactggcgatggcatatgtacgat
acagtgaaaggttctgactggctgggtgaccaagatgcaatccattacatgtgtcgcgaa
gctcctagcacggtcattgagctcgagcactttggtgtcccattctccagaacaaaagaa
ggaaaaatctaccaacgtgcttttggtggacaatctctgaagtatggtaaaggtggtcag
gcctatcgttgtgccgccgccgccgaccgtactggtcatgcacttttgcacacactctat
ggtcaatcattgcgccacaacaccaacttctttatcgaatacttcgcgctcgatttgatc
atgcaggatggcgagtgtgttggtgtgattgcgctcaacatggaagatggtactcttcac
aggttcaggtcccacaagaccgttctggcaacaggaggctatggaagagcatacttcagt
tgtacaagtgcgcatacttgctctggagatggaaatgccatggttgcccgcgctggtctt
cctctacaagacttagaattcgtccagttccaccccactggtatctatggtgctggatgc
cttatcaccgaaggttctcgtggtgagggtggatatctcctaaactcagagggcgaacgc
ttcatggagcgttacgcacctaccgcaaaggatctagcttctcgtgacgtcgtttctcgt
tcaatgaccattgaaatccgcgaaggtcgcggtgtgggacctgacaaagaccacctctac
ctccagctcagtcatttgcctcctgaagtccttcacgagaggcttcccggtatctctgag
actgccgccatcttctctggtgttgacgtcacaaaggagcctatccccgtcttgcctact
gttcactacaatatgggtggtattcccacgaaatatactggtgaggtgttgactacggat
aaggatggcaaagacaaggtggttcccgggctgtatgctgcaggtgaagcggcttgtgta
tccgttcacggtgccaaccgtctcggggccaactcccttttggacatcgtagtatttgga
cgtgcatgcgcgcaccatatcaaagataccttaactccaggaaaaccgcacaaagctatt
cccgaagaggctggcatggggagtgttgaattcctggatcaagtcaggaacgctgacggc
tcagagcccacggctaaaatcagattagacatgcagaaagctatgcaatcagatgctgct
gtcttccgtactcaggagtctttggacgaaggcgtacaaaagatgcgctctatctacaag
tcattcgacaatgttggcatcaaggacaggagcatgatctggaactccgaccttgttgaa
acactggagctccgcaacatcctccagtgcgctatccaaaccatcacagccgcagctgct
cgcaaggagtcacgtggtgcgcatgctcgtgaagatttccctgagcgtgacgatgataaa
tggatgaagcacactttgacactccagcgtgacatcaatgaaccggatgtcgagatcacg
taccgtggtgtcattggcacgacgttggatgaaagcgagtgcaaagcagttcctcccttc
aagcgcgtgtattag

DBGET integrated database retrieval system