KEGG   Sulfurimicrobium lacus skT11: SKTS_27240
Entry
SKTS_27240        CDS       T06796                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
slac  Sulfurimicrobium lacus skT11
Pathway
slac00620  Pyruvate metabolism
slac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SKTS_27240
Enzymes [BR:slac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     SKTS_27240
SSDB
Other DBs
NCBI-ProteinID: BCB27838
UniProt: A0A6F8VDP9
LinkDB
Position
2867673..2871131
AA seq 1152 aa
MDLNQFLGLGDGSEDAQEARERLQLYINLKLSSSGQPACEQGSDSNFLEVADSLLKSYRE
KSRLLSGYLCPPDQRIQSFLDDYLADVAEGVVPRLPENTLVLDRHGVARELSLPARSDEF
KSEYVSSYRIRNGVLHNPTSDRRTTKGSFHVAEDGLPIPGDKKAVPKLTFARLLKAALNP
PEHLLRLPFTATQKHEAKMFVSLLLRPVVCPEIPGHEAEKSMEIRFFAPGSLVSNLDFVE
SIFGNGGNPVLASNDAGLDVDHWSGHSGCVILAPHLVQFTKKELGLPQRDKATPRQIADG
MCWSDEGELYNDGAAFKITARDERGVIVTILADNYYGYCKKEVKTQISYAANLFGLAEEE
HAGGALAFPRHNHGEEFGVDSVTRVAGYSFEEMVANYGALMDLQPQGYAIDKLHPEVVYV
PQDLRMDLPNQTISWLQGDTRQSIKLQPGKIYVQPNGYKVEMQKHPGAPSWRLVGTDPEG
TFCHKPCTVSGGGKSEISKSMTDAVIYAPLFVANLEHDLDQVEAIFNRDYGTRFKPGCES
EDRDPSRKLLSAERSMGSVIKVLTPSPSYSDEFNVWLEGVPDRILALAFVIKRMYRPDWG
NDWRKFLSVDFVNGHPGHELKLGERKLVGSYLRVGFTEKGAWRVFKMRQDFIPAEKVQME
DDITASVVVPVEVLPNTSPKSADPCVKLVRNCEYRLFQRPDDAIHRGFDKQTEKDMAQRD
NFFANYEPLQGEKLTEIVDDVVGFGQYTEPMRNILQQAHDTGETVVSSAHPRIVDGKPSK
NPRYLQLRTDIANPVRRYVAEIGARFNRRVPLGTAVVEPVNAVLTGRRNNPPEPGIRPLA
VYNPIHYQELPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALRPTADLNNALVSFIL
SGYAGYSTAAGHVGPKLRVDHDISLLVPEIWSRLSSKVRDPRFMIENGYLEKIEDFEYQG
RPIQASRLGYRITERFVHGFMGKMFDAPRAVFGEEILRPESQGLDVFADGVENIVEAQQN
VAACYIKDGSVEDACPPLKALLHIMASGSYEGKDVHHPDIRAMFTREALLASDWYRERLE
TKQARDIALWKRHVAYLESFAVRSSHQDVAEKLDILSRVKLARTKLEWVSGSAYLQSLRG
TIGADPMGRAGK
NT seq 3459 nt   +upstreamnt  +downstreamnt
atggatctaaatcaatttcttgggttgggcgacggttctgaagatgcgcaggaagcgcgc
gaacgcctgcagctgtatatcaacctgaaattatcctcgtccggccagccggcctgcgag
caaggcagcgacagcaacttcctcgaagttgccgacagcctgctcaaaagctaccgggaa
aaatcgcgtctgctgtccggctatctgtgcccgcccgaccagcgcatccagtctttcctt
gacgactacctggccgacgttgccgaaggcgtcgtcccgcgcctgccggaaaatactctg
gtactcgaccgccacggcgtggcgcgggagctttccctgccggccaggtcggacgagttc
aaaagcgaatatgtcagcagctaccgcatccgcaacggcgtgctgcacaaccccaccagc
gaccgccgcaccaccaagggctcgttccacgtggccgaagacggcctgcccatccccggc
gacaagaaggccgtgcccaagctcacttttgcgcgcctgctgaaggctgcgctcaacccg
ccggaacatctgctgcgcctgccgttcaccgccacgcagaaacatgaagcgaaaatgttc
gtctcgctgctgctgcgcccggtggtgtgccccgaaatccccggccacgaagcagaaaag
agcatggaaatccgcttttttgccccgggcagcctggtgagcaacctcgatttcgtcgaa
agcattttcggcaatggcggcaatccggtactggcctccaacgatgccggtctcgacgtg
gatcactggtccggccacagcggctgcgtcatccttgcgccacacctggttcaattcacc
aagaaagaacttggcctgccccagcgcgataaagccacgccgcgccagatcgcggatggc
atgtgctggagcgacgaaggcgagctgtacaacgacggtgcagccttcaagatcaccgcg
cgcgacgagcgcggcgtgatcgtcaccattcttgccgacaactactacggctactgcaag
aaggaagtcaaaacccagatcagctacgccgccaacctcttcggcctggccgaagaggaa
cacgccggcggcgcactggccttcccgcgccacaaccacggcgaggaattcggtgtggac
agcgtcacccgcgtggccggttatagcttcgaggaaatggtggcgaactacggcgcgctg
atggacctgcagccccaaggctacgccatcgacaagctgcaccccgaagtggtctatgtg
ccacaggacctgcgcatggacctgccgaaccagaccatcagctggctccagggcgacacg
cgccagtcgatcaagctgcagccgggcaagatctacgtccagcccaacggctacaaggtc
gaaatgcagaagcaccccggcgcgccttcatggcgcctggtgggcaccgacccggaaggc
actttctgccacaagccctgcaccgtgtcgggcggcggcaagtcggaaatttccaagtcg
atgaccgacgccgtgatctacgcgccgctgttcgtcgccaacctggagcacgatctcgac
caggtcgaggctattttcaaccgcgactacggcacgcgcttcaagcctggctgcgaatcc
gaggaccgcgaccccagccgcaagctgctcagcgcggagcgcagcatgggctcggtgatc
aaggtgctcacgccctccccgtcctattccgacgagttcaacgtctggctggaaggcgtg
ccggaccgcatcctcgccctggctttcgtgatcaagcgcatgtatcgcccggactggggc
aacgactggcgcaagttcctgtcggtggatttcgtcaacggccaccccggccacgaactg
aagctgggcgagcgcaagctggtcggctcctacctgcgcgtaggcttcacggaaaaaggc
gcgtggcgcgtgttcaaaatgcgccaggacttcatccccgccgaaaaagtgcagatggaa
gacgacatcaccgcatcggtggtagtcccggtcgaagtgctgcccaacacctcgccgaaa
agcgccgacccgtgtgtcaagctggtgcgcaactgcgaataccgcctgttccagcgcccg
gacgacgctatccaccgcggtttcgacaagcagaccgaaaaggacatggcgcagcgcgac
aacttcttcgcgaactacgagccgctccagggcgagaagctgaccgaaatcgtcgacgac
gtggtcggcttcggccagtacaccgagccgatgcgcaacatcctgcagcaggcgcacgat
accggcgaaacggtagtgtcctcagcccacccgcgcatcgtcgacggcaaaccgagcaag
aacccgcgctacctccagctgcgcaccgacatcgccaacccggtacggcgctacgtcgcc
gaaatcggcgcgcgcttcaaccgccgcgtgccgctcggcaccgccgtggtcgaaccggtc
aacgccgtgctgaccggtcgccgcaacaacccgccggagcccggtatccgtccgctggcc
gtgtacaacccgatccactaccaggaactgcccgagctgttcatggacttcgtgtgcagc
ctcaccggcaagtcgccctccaccaccggcgccggcagcgaaggcgccctgaccaagggg
ccgttcaacgccctgcgccccacggcagacctcaacaatgcgctggtgtccttcattctc
agcggctacgccggatactcgaccgccgccggacacgtcgggcccaaactgcgcgtcgat
cacgacatcagcctgctggtgccggaaatctggtcgcgcctgtcgtcaaaggtgcgcgat
ccgcgcttcatgatcgaaaacggctacctggaaaaaatcgaggacttcgaataccagggc
cgcccgatccaggccagccgcctcggctaccgcatcaccgagcgcttcgtgcacggtttc
atgggcaagatgttcgatgctccccgcgcggtattcggcgaggaaatcctgcgtccggaa
agccagggactggacgtgttcgccgacggcgtggaaaacatcgtcgaagcccagcagaac
gtcgcggcatgctacatcaaggacggcagcgtggaagacgcctgcccgccgctcaaagcc
ctgctccacatcatggccagcggcagctatgaaggcaaggatgtgcaccaccccgacatc
cgcgccatgttcacgcgcgaagcgctgctcgcttccgactggtaccgcgaacgcctggaa
accaaacaggcgcgggatatcgcgctatggaaacgccatgtcgcctacctggagtccttc
gccgtgcgcagcagccatcaggacgtggcggaaaaactcgacattctcagccgggtgaaa
ctggccaggaccaagctggaatgggtgagcggcagcgcctacctgcaaagcctgcgcggc
accatcggcgccgatccgatggggcgcgccgggaagtag

DBGET integrated database retrieval system