KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111644345
Entry
111644345         CDS       T06058                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04020  Calcium signaling pathway
slal04144  Endocytosis
slal04510  Focal adhesion
slal04540  Gap junction
slal04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111644345 (pdgfra)
   04020 Calcium signaling pathway
    111644345 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111644345 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111644345 (pdgfra)
   04540 Gap junction
    111644345 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111644345 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111644345 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:slal04090]
    111644345 (pdgfra)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111644345 (pdgfra)
Protein kinases [BR:slal01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111644345 (pdgfra)
CD molecules [BR:slal04090]
 Proteins
  111644345 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 111644345
NCBI-ProteinID: XP_023248959
LinkDB
Position
Unknown
AA seq 1472 aa
MDGARTCVVFGGVLLALVSVTCGLSPPTIVSNQEEFILQPGSRLNISCTGKRSVVWAEPL
PENTFVLPGYFTSTLFIYNATVGNTRYYMCVYEGREGDLQSEEEEEENEAGIYVFVPDPE
AAFVPDVPEHLVVPMDSPGVPISCRVSHPHSDVILRSVPGGEEMPAYYDNKMGFFGNLAP
GQYQCETAGVNGRTARSDIYTVKIKAPAKQEDFGVEVKASEESVRAGQPLNITCVAPTGP
GFQQQWLHPKKQAVDAVQTKHTLPDRVIYTLRIPQATSQDSGTYECSITSEISGEVRVGS
VAVTVFEENSFVALDHSGILAVESVSLLEETEYTILINAYPAPKVTWLKDGKAMTGNYYT
HTKTSRIEGNRYQSILTLRQPLEKDNGNYTITAASGSRTAHFSFILTVKASTAVMFLPSS
APVLLPQMDEMVVPLHAPFTLTCRGEAKLAWETPLDVPEQTQEDNSGLFVTTVTVDSAEA
MHTGYYTCFYSKNTTEEAEDSRIYIYVPDPDNPFVPSPVPFGNHVLFGHEEMEIHCRVSD
PSANVTLINVDTQQPVPSVYDSKRGALGVFTSGTYICKAIINGEEHYSEEYIVHGWTGGA
GLHVELTAKRTALLVGDTVTVTCLARGSEILEDHWKYPGKLAKRAVKTVHENKRDQEILY
TLTIPQASTKDSGIYSCSITDIITNENQTKHLAISVFASEFMSIHPQFREYESAELDEVR
EFRAEISSFPTARVTWLKDGNPLGDVTAEISTSLRPLSETSYMSVLTLIRAKEEDSGNYT
MRVENGNQIQDVGLNLEVKVPAVIVELMDIHHGSATGQAVVCITRGQPTPVVEWFVCKNI
KHCANDSSSWSPLLTNSTEISVDSHIDEDNNLESQVLFGHLENTLAVRCLARNEMASVSR
EVKLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVVWKQKPRYEIRWRVIESVSPDGHEY
IYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPT
ARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNREN
FLSLNPEKNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNTS
KYSDIQRSNYDSPPLQKGSSEGEGDNLLSDDSNEGLSTTDLLSFTYQVAKGMEFLASKNC
VHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTT
LSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWN
SEPEKRPSFLGLSDTVASLLPSSYKRHYERVNHEFLKSDHPAVTRVCMENDAYIGIAYKN
QGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSSS
TFAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggatggggcgaggacgtgtgtcgtgtttgggggggttctgttggcgctggtttcagtt
acctgcggactgtcgccaccgaccatcgtgtccaaccaggaggagttcatcctgcagccc
ggctcccgcctcaacatcagctgcaccgggaagaggagcgtcgtctgggccgagccgctg
ccggagaacaccttcgtgcttccgggatacttcacgtcgacgctcttcatttacaacgca
acagtgggaaacacccgctattacatgtgtgtctatgaagggcgggagggcgacctgcag
agtgaggaagaagaggaagagaatgaggcgggaatttatgtctttgtgccagacccagag
gccgcctttgttccggatgtccctgaacacttggtggtgcccatggactcgcccggtgtc
cccatctcctgccgtgtgtctcaccctcactcggacgtcatcctcaggagcgtccccggc
ggagaggagatgcccgcctactacgacaacaagatgggcttcttcggaaacctcgctccc
gggcagtaccagtgcgaaaccgccggcgtgaacggccgcacggccagaagtgatatctat
actgtgaagataaaggcccccgccaagcaggaggatttcggcgtggaagtgaaagccagc
gaggagagcgtgagagccggacaacctctcaacatcacctgcgtcgctcccaccgggccg
ggctttcagcagcagtggctccatcctaaaaaacaggctgtggacgcagttcagacgaaa
cacacgcttcctgaccgggtcatctacaccctgcgtatcccacaagccacctctcaggac
agcggcacctacgagtgctccatcacatcagaaatcagcggcgaggtcagagtcggcagc
gtggccgtcaccgtcttcgaggagaattccttcgtggctctggaccacagtgggattcta
gcggtggagtctgtcagccttttggaggagactgagtatactattctcatcaatgcctac
ccggcccccaaagtgacatggctgaaagatggaaaagccatgaccgggaactactacacc
cacaccaagacgagccgcattgaagggaatcggtatcagagcattctgacattacggcag
cctctggagaaagacaacgggaattacaccattacagccgccagcggctcccgcaccgct
cacttctccttcatcctcacagtgaaagcctccactgcagtgatgttcctcccgtcctcg
gcccctgtgctgctgccacagatggacgagatggtggtgccgctccacgctcctttcacc
ttgacctgccgtggagaggcgaagctggcctgggaaacgccgctcgatgtgcccgagcag
acgcaggaggacaacagtggcctgtttgtcaccacagtcactgtggatagcgccgaagca
atgcacacgggctactacacatgcttctacagcaaaaacaccaccgaggaggcggaggac
agcaggatctacatctatgtgccagatccagataatcccttcgtgccatcgccggtgcct
ttcggtaaccacgtcctgttcggccatgaggagatggagatccactgtcgagtgtctgat
cccagcgctaacgtgaccctgatcaatgtcgacacccagcagcccgtgcccagtgtttat
gacagcaagaggggggctttgggggtgttcacttctggaacctacatttgtaaggccatc
atcaacggagaggaacactacagcgaggaatacatcgtccacggctggacaggtggtgct
gggctgcacgtcgagctgacagccaagcggaccgctctgctggtgggggacaccgtcacg
gtcacctgtctggctcgggggtcagagattctggaagaccactggaaataccctggaaaa
ctggccaaacgtgccgtgaaaacggtgcatgagaataagagggatcaggagattctctac
accctgacgatccctcaggcttcaaccaaagacagcggcatctactcctgctccatcacc
gatattattactaatgagaaccagacaaagcatctagctattagtgtttttgcgagtgag
ttcatgtccatccatccacagttcagagagtatgagtcagcagagctcgatgaggtccgt
gagttcagggctgaaatcagctccttccccacggctcgtgtcacgtggctcaaggatgga
aacccactcggcgacgtgacagcggagatctccaccagcctccggccgctcagcgagacc
agctacatgagtgttctcaccctgatccgggccaaagaggaggacagtgggaactacacc
atgcgtgtggagaatggaaaccaaattcaggacgttggcttaaacctggaggtcaaagta
cctgcagtcattgtggagctgatggacatccaccacggctcagccacaggccaggctgtg
gtgtgcattaccagagggcagcccactcctgtggtggagtggtttgtctgcaagaacatc
aaacattgtgccaatgactcgtcctcctggtcccccctcctcaccaactccaccgagatc
tcagtggactcccacatcgacgaggataacaacctggagagccaggtcctgtttggtcac
ctggaaaacaccctggcggtacgctgcttggccaggaacgaaatggcgtccgtcagcagg
gaggtcaaactggtgtctaatggccctcaccctgagctgactgtagctgctgctgtgctg
gtgctgctggtcattgtcatcatctcactcattgtgttggttgttgtctggaaacagaaa
ccacgatatgagatccgctggagggtcatcgagtccgtgagcccagacggccacgagtac
atctatgtggatcccatgcagcttccctacgactccagatgggagttcccccgtgacaga
cttgtgctcggtcgtatcctgggctctggagcctttgggaaggtagtggagggaaccgcc
tatggactcagccgctcccagcccgtcatgaaggtcgcagtgaagatgctgaaacccaca
gcacgctccagtgagaaacaagctctgatgtctgaactgaagattatgactcatctcgga
cctcatctaaacatcgtcaacctcctgggagcgtgcaccaagtcaggccctatctacatt
atcacagagtactgcttctacggggacctggtcaactacctgcacaagaacagggagaac
ttcctgagcctgaacccagagaaaaataaaaaggagctggatatctttgggatcaaccct
gcagatgagagcagccggagttatgtgatcctgtccttcgagagcaaaggagactacatg
gacatgaagcaggctgacaacactcagtatgtgcccatgctggagatgagcaacacctcc
aagtactcagacatccagaggtccaactacgacagcccccccctgcagaaaggctccagc
gagggcgagggggacaacctgctgtcagacgactcaaacgagggcctcagcaccaccgac
ctgctcagcttcacctaccaggtggccaaaggcatggagttcctggcttccaaaaattgt
gtgcaccgggacctcgcagccaggaatgtgctcctctctcagggcaagatagtgaagatc
tgtgacttcggactggctagagacatcatgcatgacaacaactatgtctccaaaggaagc
acttttctgccagtgaagtggatggcaccagagagtatttttgacaacctgtacaccact
ctgagcgacgtctggtcctacggcatcctcctctgggagatattctccttaggtggcacc
ccgtacccagggatggtcgtggactcgagcttctacaacaagatcaagagcggatacagg
atgtccaaacccgaacacgcacctcatgacgtgtatgagatgatgatgaagtgctggaac
agcgagccagagaagaggccttctttcctgggtctgagtgacaccgtggcttctttgctg
ccctccagctacaagaggcattacgagagggtaaaccacgagttcctgaagagcgaccac
cccgccgtgactcgggtgtgcatggaaaatgacgcctacatcggcatcgcttacaagaac
cagggcaagctgaaggacagggagagcggctttgacgagcagcggctgagctccgacagc
ggctacattatccccctcccagacctggacccaatatctgatgatgaatatggaaagagg
aacagacacagctctcagacgtccgaggagagcgccatcgagacaggctccagcagctcc
acgtttgctaaacgcgagggtgagaccctggaggacatcacgctgctggacgagatgtgt
ctggactgtagtgacctggtagaggacagctttctgtga

DBGET integrated database retrieval system