KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111644420
Entry
111644420         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111644420
   04068 FoxO signaling pathway
    111644420
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111644420
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111644420
   04920 Adipocytokine signaling pathway
    111644420
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 111644420
NCBI-ProteinID: XP_023249062
LinkDB
Position
Unknown
AA seq 336 aa
MEPPSQVSFPEKKKGIQKQEADVTVYMNFMKSHCCYEAIPTSSKLVIFDTTLQVKKAFFA
LVANGLRAAPLWDSKLQRFVGMLTITDFINILHCYYKSPMVQMYELESHKIETWRGDSFQ
NVYLQYSNHFLISISPEASLFDAIYSLLKHKIHRLPIIDPASGNVLHILTHKRILKFLHI
FGRRVPKPAFIHGQIQQLGIGTFRNIATVQQTASLYDALSIFVDRRVSALPVVDQQGKVV
ALYSRFDVINLAAQKSYGNLDMTMLEAVRRRTCFVEGVIKCYPDETLETIIDRIVKAEVH
RLVLVDRADVVRGIISLSDLLQAMVLTPAGIDALLS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggagcccccttcacaggtgtcattcccagaaaagaagaagggaatacagaaacaagag
gctgatgtcaccgtctacatgaacttcatgaagagccactgctgctatgaagccattcca
accagctctaaactggtcatatttgataccacactacaagtgaaaaaggccttttttgca
ctggtggcaaacggcttgagggctgcgcctctgtgggacagcaagctacagagatttgtg
ggtatgctgactattacggatttcatcaacatcctccattgctattacaagtctcctatg
gttcagatgtatgagctggagagccacaagattgagacatggagaggtgattcatttcaa
aatgtctatttacagtattccaatcacttcctcattagtatttctccagaggctagcctc
ttcgatgccatctattccttactcaaacataagatccacaggctgcccatcatcgaccca
gcatctggaaatgtcctgcatatcctgacccacaaacgaatcctcaagttccttcatata
tttgggagaagggttcctaagcccgcgttcattcatgggcagatccagcagcttgggatc
ggaactttcaggaacatcgccactgttcagcaaacagcatcactttatgatgccctctct
atatttgtggacaggcgggtgtctgcgctgccggtggtggaccaacaaggcaaggtggtg
gcactctactccagatttgatgtgattaacctagcagcccagaagagctacggcaatctg
gacatgactatgctggaagccgttcgcaggcgcacgtgttttgtggagggagtcatcaag
tgctatcctgatgaaaccctggagactatcatagaccgtatcgtcaaagcagaggtccat
cggctggtcctggtggacagggctgatgtggtgaggggcatcatctctctgtctgacctg
ctgcaggccatggtcttaacccctgcaggtatcgacgcccttttgtcctag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645026
Entry
111645026         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111645026
   04068 FoxO signaling pathway
    111645026
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111645026
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111645026
   04920 Adipocytokine signaling pathway
    111645026
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 CBM53
Other DBs
NCBI-GeneID: 111645026
NCBI-ProteinID: XP_023249812
LinkDB
Position
Unknown
AA seq 268 aa
MGNSSSDRSSGGQGERSYRDGQQGGKEARPNILMDSTEDADLFQRDDSKAPQEIQEFLAW
QQDLESDSKSPTQARPTVFRWSGAAKEVFVSGSFNNWATKIPLNRSQKNFVAVVDLPEGE
HQYKFCVDGQWTLDPTGAVMTSKTGTVNNIIQVKTTDFEVFDALRIDSQDSADISDLSSS
PPGPYQQDAYVTKSEDKIKHPPILPPHLLQVLLNKDTGVSCDPTLLPEPNHVMLNHLYAL
SIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 807 nt   +upstreamnt  +downstreamnt
atggggaacagcagcagcgacagatccagcgggggtcagggtgagaggtcgtacagggat
ggacagcagggagggaaagaggctcgtcccaacatcctgatggacagcacagaggacgca
gatcttttccagagagacgattcaaaggctccgcaggaaatacaggagtttctggcctgg
cagcaggacctggagagtgacagcaagagtccaactcaggccaggccaaccgtgttcaga
tggtcaggggccgccaaagaagtcttcgtgtccggctcctttaacaactgggccacaaag
atcccactcaacagaagtcagaagaactttgtggctgtagtggacctgccggagggagag
caccagtacaagttctgtgtggatggtcagtggactctggatccgactggggctgtgatg
acgtctaaaaccggaacagtcaataacattatccaggtgaaaacgactgactttgaagtc
tttgacgccctcagaattgactcgcaggattctgcagatatctcagacttgtccagttcc
ccacccggcccctaccaacaggacgcgtatgtgaccaaatcagaagacaagatcaaacac
cctcctatcttacctccccacctgctgcaagtgctgctcaacaaggacacaggtgtctct
tgtgacccgacgctacttccggagcctaaccatgtgatgcttaatcacctgtacgccctc
tccatcaaggacggggtgatggttctcagtgcaacacaccgatacaaaaagaagtatgtg
accactcttctgtacaagccaatataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111647310
Entry
111647310         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111647310
   04068 FoxO signaling pathway
    111647310
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111647310
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111647310
   04920 Adipocytokine signaling pathway
    111647310
SSDB
Motif
Pfam: CBS Trypan_PARP
Other DBs
NCBI-GeneID: 111647310
NCBI-ProteinID: XP_023252698
LinkDB
Position
Unknown
AA seq 544 aa
MDEEDGKDGRRMETGRGRERRKSASWIMVEDRAGGQTDRKPKETDRRTLRRRSEPCGILY
VQLLPLSIRKRRQLLQRRTGRRTSCSEEGDGQMSRDRLEPFDLLDKTHSLSSPPPPPPPR
QEEVSVFRLETYLTEPRRPETRRLRSFSSPPDTGQRSSSRCQLPPLAPPLPVRKLVEVAD
SMSEQPDPDDAASEESERDIYMRFMKCHKCYDIIPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVAQSKCLCLHQVQIYELEEHKIETWRELYLQETFKPLVHISPDASI
FEAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPMPAFMKQTLEELGV
GTYANIAYIHPDTALITALSVFTHRRVSALPVVDHHGKVVDIYSKFDVINLAAEKTYNNL
DVTVTQALRHRSQYFEGVMKCNKLETLETIVDRIVKAEVTHTHTHTHTLIRLSDKCGLGR
KESLPSQPAALGSTGPESSCKPDRDRDRDQDQDPELCTEIETESKPEPDLEPGKDPETET
CGHI
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggatgaggaggatgggaaagacgggaggaggatggagacgggcagaggcagagaaagg
aggaagtctgcgtcgtggatcatggtggaggacagagcaggaggacagacggacaggaag
ccgaaggagacagacagacggacgctgcggcggcggtcagagccctgcggcatcctgtat
gtccaactacttcctctgtccatcaggaagaggaggcagctgctgcagagacgcacggga
cgcaggacgtcctgcagcgaggagggggacggacagatgagcagagacaggttggagccc
ttcgaccttctggacaagacccacagcctctcctcaccccctcctcctcctccccctcgt
caggaggaggtgagtgttttccgtctggagacgtacctgactgagccgaggcgtccggag
accaggaggctgcgctccttctcctcacctcccgacaccggacagcgctcctcctcccgc
tgccagctgcctcctctggctccgccccttcctgtcaggaagctggtggaggttgcagac
agcatgtcggagcagccggaccccgatgatgccgcatcggaggagtcggagagagacatc
tacatgcgcttcatgaagtgtcacaagtgttacgacatcatccccaccagctctaaactg
gtggtgttcgacaccacactgcaggtgaagaaagcgttctttgctcttgtggcaaatgga
gtgagagctgctccactgtgggagagcaagaaacagagctttgtggcacagtcaaagtgt
ctgtgtctccatcaggttcagatctatgagctggaggaacataagatcgagacgtggaga
gagctgtacctgcaggagaccttcaaacctctggtccacatctcacctgatgccagtata
tttgaggctgtgtactcgctgataaagaataagatccatcgtcttcccgtcatcgaccca
gtgagcgggaacgctctctacatcctcacacacaagaggatcctcaagttcctgcagctg
tttgtgtgtgagatgcccatgccggccttcatgaagcagactctggaggagctcggcgtg
gggacgtacgccaacatcgcctacatccaccccgacacggcgctcatcaccgcgctgtct
gtcttcacgcaccgccgtgtgtccgccctgcccgtcgttgatcaccatggtaaagtggtg
gacatctactccaagtttgacgtcattaacctggcggcagagaagacctacaacaacctg
gacgtgacggtcactcaggctctcagacaccggtcccagtacttcgaaggagtcatgaag
tgcaacaagctggaaacactggagaccatcgtggaccgcatcgtgaaggctgaggtgaca
cacacacacacacacacacacacactgatcaggctttcagacaaatgtggtctcgggagg
aaggagtctctcccctctcagccagcagctttgggctcaacaggaccagagtcaagctgt
aaacctgaccgggaccgggaccgggaccaggaccaggaccccgagctttgcacagagata
gaaacagaaagcaaacctgaacctgatctggaaccaggtaaagacccagagacagagacg
tgtggacacatctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111648137
Entry
111648137         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111648137
   04068 FoxO signaling pathway
    111648137
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111648137
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111648137
   04920 Adipocytokine signaling pathway
    111648137
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 111648137
NCBI-ProteinID: XP_023253681
LinkDB
Position
Unknown
AA seq 159 aa
IFEAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFVCEMPMPAFMKQTLEELG
VGTYANIAYIHPDTALITALSVFTHRRVSALPVVDHHGKVVDIYSKFDVINLAAEKTYNN
LDVTVTQALRHRSQYFEGVMKCNKLETLETIVDRIVKAE
NT seq 477 nt   +upstreamnt  +downstreamnt
atatttgaggctgtgtactcgctgataaagaataagatccatcgtcttcccgtcatcgac
ccagtgagcgggaacgctctctacatcctcacacacaagaggatcctcaagttcctgcag
ctgtttgtgtgtgagatgcccatgccggccttcatgaagcagactctggaggagctcggc
gtggggacgtacgccaacatcgcctacatccaccccgacacggcgctcatcaccgcgctg
tctgtcttcacgcaccgccgtgtgtccgccctgcccgtcgttgatcaccatggtaaagtg
gtggacatctactccaagtttgacgtcattaacctggcggcagagaagacctacaacaac
ctggacgtgacggtcactcaggctctcagacaccggtcccagtacttcgaaggagtcatg
aagtgcaacaagctggaaacactggagaccattgtggaccgcatcgtgaaggctgag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111649950
Entry
111649950         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2-like isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111649950
   04068 FoxO signaling pathway
    111649950
   04150 mTOR signaling pathway
    111649950
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111649950
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111649950
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111649950
   04920 Adipocytokine signaling pathway
    111649950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111649950
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111649950
   03029 Mitochondrial biogenesis [BR:slal03029]
    111649950
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111649950
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111649950
Membrane trafficking [BR:slal04131]
 Autophagy
  Other autophagy associated proteins
   Others
    111649950
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111649950
  Mitophagy factors
   Other mitophagy factors
    111649950
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 111649950
NCBI-ProteinID: XP_023255421
LinkDB
Position
Unknown
AA seq 556 aa
MLCLTPCVSAWVCFIFIICVLYLLHMCVLYLSVGEHQLTGHKVAVKILNRQKIRSLDVVG
KIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDTEARRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDASKNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLTR
SVASLLMLMLQVDPLKRATIKDIREHEWFKQDLPGYLFPEDPSYDATVLDEEAVREVCEK
FECMESEVMSSLYSGDPQDQLAVAYHLIIDNRRIMTQASEFYLASSPPQGSFIEEGMPLP
PGVKPHPERMPPLLADSPKSRCPLDALNTTRPKPLAVKKAKWHLGIRSQSRPYDIMAEVY
RAMKQLNFDWKVVNPYHLRVRRKNPVTGNLVKMSLQLYQVDSRSYLLDFKSIDDDIIEAV
GFKSGSSTPQRSGSTAGLHRPRLSIDSASPAFDLPQLSSSLPGSLSGSNPLLTPRQGSHT
MDFFEMCASLITTLAR
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgttgtgcctaacgccttgtgtatcagcttgggtgtgtttcatttttatcatctgtgtt
ttgtatctgcttcatatgtgtgttctttatctttcagttggagagcatcagttgacaggc
cataaagtggctgtaaagatcctaaacagacagaagatccgtagcctcgatgtcgtgggg
aagatcaagcgagagatccagaatctcaaactgttcagacacccacacatcatcaagctg
taccaggtgatcagtacacccactgatttcttcatggttatggagtatgtgtctggaggt
gagctgttcgactacatctgcaaacatggacgggtggaggacacagaagctcgccgtctc
ttccagcagattatctcagccgtggactactgccacaggcacatggtggtccacagagac
ctcaaaccagagaacgtcctgctggacgccagcaagaacgccaagatcgccgactttggt
ctgtcaaacatgatgtcagatggggagtttttacggacgagctgtggctcccccaactac
gctgctccagaggtcatctcaggaaggctctatgcaggtccagaggtggacatctggagc
tgtggcgtgatcctgtacgccctgctctgcggcacgctgccctttgacgacgagcacgtc
cccacgctgtttaagaagatcagaggaggcgtcttctacatccccgagtacctgacccgc
tccgtggcctcgctgctcatgctcatgctccaggtcgatcctctgaagagagccaccatc
aaagacatcagggaacatgagtggttcaagcaggacctgccgggatacctgttccctgaa
gacccttcgtacgatgccacagtcctggatgaggaggccgtcagagaagtgtgtgagaag
tttgaatgtatggagtcagaggtgatgtccagcctttacagcggagatccacaggatcag
ctggccgtggcctatcacctcatcatagacaaccggcgcatcatgacccaggccagcgag
ttctacctggcctccagtcctccccagggctccttcatagaagaaggcatgccgctgccc
cccggagtcaaaccccacccggagaggatgcctccgctcctggctgacagccccaagtct
cgttgtcctctggatgctcttaacaccacccggcccaaacctctggcagtgaagaaggcc
aagtggcacctcggcatccggagtcagagcagaccctacgatatcatggctgaagtgtac
agggcaatgaaacaactcaactttgactggaaggtggtgaacccgtatcacctgcgagtg
cggaggaagaatccggtgacgggcaacctggtgaagatgagcctgcagctgtaccaggtg
gacagcaggtcctacctcctcgacttcaagagcatcgacgatgacatcatcgaggcggtg
ggctttaaatctgggtcgtccactcctcagcggtcgggctccacagccggtctccacaga
cccagactgagcatcgactctgcgagcccggccttcgacctgccccagctcagctcctcc
ctcccgggatcgctgtccggcagcaaccctctgctcaccccacgccagggatcgcacacc
atggacttctttgaaatgtgcgccagtctgatcaccacgctcgcgcgctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650214
Entry
111650214         CDS       T06058                                 

Definition
(RefSeq) serine/threonine protein kinase OSK1-like
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111650214
   04068 FoxO signaling pathway
    111650214
   04150 mTOR signaling pathway
    111650214
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111650214
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111650214
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111650214
   04920 Adipocytokine signaling pathway
    111650214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111650214
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111650214
   03029 Mitochondrial biogenesis [BR:slal03029]
    111650214
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111650214
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111650214
Membrane trafficking [BR:slal04131]
 Autophagy
  Other autophagy associated proteins
   Others
    111650214
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111650214
  Mitophagy factors
   Other mitophagy factors
    111650214
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like UBA_2 APH RIO1 Kdo ABC1
Other DBs
NCBI-GeneID: 111650214
NCBI-ProteinID: XP_023255831
LinkDB
Position
Unknown
AA seq 327 aa
MSSHVQRIGHYRLGKNLGIGSFGKVRLAEHQLTGKKVAVKILNRNRIRQLDMDEKVRREI
KILKLFYHPHIIRLYEIIYTPTDIYMVMEYVPGGELFDFIVSNGRLSEPRARAMFQQLIS
GVEYCHQHAVVHRDLKPENLLLDAEQQLRIADFGLSNVMKDGDFFKTSCGSPNYAAPEVI
SGKLYAGPEVDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIFTLPGHMSDEIKDLI
SRMLVVDPLQRITIPEIRRHRWFTDELPLYLSVTPDQIMSQIRSIDQDVLMEVVMKIGFD
RQELEEALEKQERNQMTVAYYLILDSK
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtcatcgcacgtccaaaggatcggccactaccggctggggaagaacctcggcatcggg
tcctttggcaaagttcgactggccgagcaccagctgaccggcaagaaggttgcggtcaag
atcctgaaccggaaccggatccggcagttggacatggacgagaaggtgcgccgcgagatc
aagatcctcaagctcttctaccacccccacatcatccgcctctacgagatcatctacact
ccgacagacatctacatggtgatggagtacgtgcccggcggagagctcttcgacttcatc
gtctccaacggccgcctctccgagccgcgcgcgagggccatgttccagcagctcatctcg
ggagtcgagtactgccaccagcatgccgtcgtccaccgcgacctcaagcccgagaacctt
ctcctcgacgccgagcagcagctccgcatcgcagactttggactctcaaacgtgatgaag
gacggcgacttcttcaagacgtcgtgcggctctccgaactacgccgcgccggaggtcatc
tcgggcaagctctacgcggggccggaggtcgacgtctggtcgtgcggcgtcatcctgtac
gccttgctgtgcggctccctgcccttcgacgacgagaacatcccaaacctcttcaagaag
atcaagggcggcatcttcactctccccggacacatgtccgacgagatcaaggacctcatc
tcccggatgcttgtcgtcgacccgctgcagcgcatcaccatccccgagatccggcggcac
cgctggttcaccgacgagctccccctctacctctccgtcacgcccgaccagatcatgtcg
cagatccggtctatcgaccaggacgtgctgatggaggtggtgatgaagatcggcttcgac
cggcaggagctggaggaggccctcgagaagcaagagcgcaaccagatgacggtcgcctac
tacctgatcctcgactcgaag

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111654804
Entry
111654804         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111654804
   04068 FoxO signaling pathway
    111654804
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111654804
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111654804
   04920 Adipocytokine signaling pathway
    111654804
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 111654804
NCBI-ProteinID: XP_023261710
LinkDB
Position
Unknown
AA seq 268 aa
MGNTSDRVSGDRHGAKAHRSDSSGSHKDQEHSSKMVDSTDDPNIFNTHGPESKALGEKEF
TPDLDDLVKPGPQARPTVIRWAGGGKEVYIAGSFNNWGTKIPLNKSHNDFVAILDLPEGE
HQYKFFVDGQWVHDPSEPVVTSQLGTINNLIQVKKSDFEVFDALQVDSLECSDTSDLSSS
PPGPYGQEQYIFRPEEHFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYAL
SIKDGVMVLSATHRYKKKYVTSLLYKPI
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcaacacaagtgatagggtgtctggagatcgccatggagccaaagcccaccgctcg
gacagtagcggcagtcacaaagaccaagaacacagcagcaagatggtggacagcacagat
gaccccaacatcttcaacacccatgggcctgagtccaaggcattaggagagaaagaattc
accccagatctggatgacctggtgaagcctggtcctcaggctcgacccactgtgatccga
tgggcaggtggagggaaggaggtctacatagctggttcctttaataactggggcacaaag
ataccgctaaataagagtcataatgactttgtagcgatcctggacctgcctgaaggagag
caccagtacaagttttttgtagatgggcagtgggtccacgatccctctgagccagtggta
accagccagctcggcaccatcaacaacctgatccaggtgaagaagtctgactttgaggtg
tttgatgccctgcaggtcgactctctggagtgctcagacacatcagatctgtccagctcc
cctccaggtccatatggacaggaacagtacatcttcagacccgaggagcatttcaaagcc
ccaccgatactccctcctcacctccttcaagtcatactcaacaaagacaccaatatatct
tgtgaccctgccctgctgcctgaacccaaccacgtcatgctaaatcacctgtacgctctc
tcaataaaggatggagtgatggtgctgagtgcgactcacagatacaagaagaaatacgtc
acttctctgctttacaagcctatctaa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655957
Entry
111655957         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111655957
   04068 FoxO signaling pathway
    111655957
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111655957
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111655957
   04920 Adipocytokine signaling pathway
    111655957
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758 CBM53
Other DBs
NCBI-GeneID: 111655957
NCBI-ProteinID: XP_023263301
LinkDB
Position
Unknown
AA seq 269 aa
MGNTSSERAAMGQGEKAQRRDSRGIKEGERPKILMDSPEDADIFHGEDLKAPLEKEEFLA
WQQDLEADDKAPTLDRPTVFRWTGDGKEVYLSGSFNNWANKIPLIRSQNTFVAIVDLPEG
EHQYKFYVDGQWTHDPAEPVVTSQLGTVNNVIQVKKTDFEVFDALMVDSQKCSDMSDLSS
SPPGPYHQDAYIPKQEEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYA
LSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 810 nt   +upstreamnt  +downstreamnt
atggggaatacaagcagtgagagggccgcgatgggccagggggagaaggctcagcgcagg
gacagccgaggtatcaaggagggagagagaccaaagatcctgatggacagcccagaagat
gctgatatttttcatggtgaagatttgaaagctcctttagagaaagaggagttccttgca
tggcaacaagacttagaagcagacgacaaagccccaactttagaccggccaacagtattt
cgctggactggagatggcaaggaggtctacctctctgggtccttcaacaattgggccaac
aagattcctcttattagaagtcaaaacacctttgtggccattgtggatctgcctgagggg
gagcatcagtacaagttttatgtggacggccagtggacccatgacccagctgagccggtt
gtgaccagccagctgggcacagtcaataatgtcatccaggtgaagaaaacagactttgag
gtgtttgatgctttaatggtggactcacagaaatgttctgacatgtcagacctctccagc
tctcctcctggaccatatcatcaggacgcctacattccgaaacaggaagagaagtttaag
tctccacccatactcccaccgcacttgcttcaggtcatcctcaacaaagacacggggata
tcttgtgaccctgcgttactcccagaacccaatcatgtcatgctcaaccacctctatgct
ctttcaattaaggatggggtgatggtgctcagcgcgacacatcgctacaagaagaagtac
gtcaccaccttgctatataagcctatctga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111667735
Entry
111667735         CDS       T06058                                 

Gene name
prkag1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111667735 (prkag1)
   04068 FoxO signaling pathway
    111667735 (prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111667735 (prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111667735 (prkag1)
   04920 Adipocytokine signaling pathway
    111667735 (prkag1)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 111667735
NCBI-ProteinID: XP_023279272
LinkDB
Position
Unknown
AA seq 330 aa
MECIPANIDDFEAKKDPVIEDPEHNVYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFF
ALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWRELYL
QDSFKPLVCISPNASLYDAVSSLLTNKIHRLPVIDPLTGNTLYILTHKRILKFLKLFISE
MPKPSFLSQTLEELNIGTFKNIAVVRSDTPLYTALGIFVEQRVSALPVVDDKGRVVDIYS
KFDVINLAAEKTYNNLDVTVTKALQHRSQYFEGVLTCHRHETLEAIINRLVEAEVHRLVV
VDEQDVVKGIVSLSDILQALVLTDGEEGAA
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtgtattccagcaaatattgatgattttgaagccaaaaaggacccagtcatagag
gacccagagcacaatgtgtacacccggtttatgaagtcccaccggtgttatgaccttgta
cctaccagctccaaattagtggtgtttgacacatcacttcaggtgaagaaggcatttttt
gcacttgtttcgaatggggtaagagcagcgccactgtgggacagtaagaagcagtgcttt
gttggtatgctaaccatcacagacttcattaacattcttcatcgctactacaaatctcca
ctggttcaaatatatgagttggaagaacacaaaattgagacatggagagagctctacctt
caagactctttcaagcccttggtttgcatatctcccaatgcaagtttgtatgatgcagta
tcatctctgctgacgaacaagatccacagattgcctgtaatcgaccccctgacagggaac
acactctatattctcacacacaagaggattctcaagttcctgaagctttttatatcagaa
atgccaaaaccgtcattcttgagtcaaactctagaggaactgaacatcggaactttcaag
aacatagcggtggtccgctcagacacaccactatacacagcgctgggtattttcgttgag
cagcgagtgtcagcgctgcccgttgtggatgacaaaggtcgagtggtggatatatactca
aaatttgatgttataaacctggctgcagagaagacgtacaacaacctggatgtgacggtg
actaaagccttgcagcaccggtctcagtactttgaaggagttctgacctgccacaggcac
gagaccctggaggccatcatcaacagactggtggaggctgaggtgcacaggctggtggtt
gtggacgagcaggatgtcgtgaagggaattgtctctctttcagatattctccaggcacta
gtgcttactgatggagaagagggcgctgcttga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111668062
Entry
111668062         CDS       T06058                                 

Gene name
prkaa1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04140  Autophagy - animal
slal04150  mTOR signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111668062 (prkaa1)
   04068 FoxO signaling pathway
    111668062 (prkaa1)
   04150 mTOR signaling pathway
    111668062 (prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111668062 (prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111668062 (prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111668062 (prkaa1)
   04920 Adipocytokine signaling pathway
    111668062 (prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111668062 (prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111668062 (prkaa1)
   03029 Mitochondrial biogenesis [BR:slal03029]
    111668062 (prkaa1)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     111668062 (prkaa1)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   111668062 (prkaa1)
Membrane trafficking [BR:slal04131]
 Autophagy
  Other autophagy associated proteins
   Others
    111668062 (prkaa1)
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111668062 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    111668062 (prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH YukC
Other DBs
NCBI-GeneID: 111668062
NCBI-ProteinID: XP_023279768
LinkDB
Position
Unknown
AA seq 573 aa
MATEKPKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLNP
SVISLLKHMLQVDPMKRATIKEIREDDWFKQDLPKYLFPEDPSYSNNMIDDEALKEVCEK
FECTEEEVLACIYSRNHQDPLAVAYHLIIDNRRIMSEAKDFYLASSPPDSFLDDQHLTSS
GAAVAGIIKPHPERVPFLLAETPPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPND
IMSEVCRAMKQLDYEWKVVNPYYLRVRRKNPITGMQTKMSLQLYQVDSRTYLLDFRSIDD
DMLETKSGTATPLRSGSVGNYRTTIKNDVDGADAPPTSSVVHPTKAAEGSLASSLTSSID
STGGGDNASVPRPGSHTIEFFEMCANLIKLLAR
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcgacggaaaaaccgaaacatgaaggaagagttaaaattggacattacattctcgga
gacacgctcggagttgggacgtttggaaaggttaaagtgggccaacatgagctgaccaag
caccaagtggcagtaaagatcttgaacaggcagaagatccgcagtttggatgtggtggga
aagattcgtcgggagatccagaatctcaagcttttcaggcatcctcacataattaaactg
tatcaggttatcagcacccccacagatatcttcatggtgatggagtatgtctcaggagga
gagctctttgattacatctgcaaaaatggaaagttggatgaaaaggagagtcgccggctg
ttccagcagattatttcagcagtagactattgccacagacacatggtggttcaccgagac
ctcaagcctgaaaatgtgctgcttgatgcccatatgaatgccaagatcgctgactttggt
ttgtcaaacatgatgtcagacggagagttcctgcgaacaagctgtggttctccaaactat
gctgctcctgaggtcatctcaggaaggttatatgctggtccagaggtggatatctggagc
agtggggtcattctctatgccttgttgtgtgggacacttcccttcgatgacgaccatgtg
ccaacactctttaaaaagatctgtgatgggatctttttcacgccacagtatctgaaccct
tcagtaataagcctccttaaacacatgctgcaggtggaccccatgaaaagagccactatc
aaagagatccgagaggatgactggttcaaacaggacctgcctaaatacttgttccccgag
gacccctcctacagcaacaacatgattgacgatgaggccctgaaggaagtatgtgagaag
tttgagtgcactgaggaggaggtcctggcctgcatatacagtcgcaaccatcaggaccca
ctggccgtcgcctaccacctcatcattgacaatcgtcgcatcatgagtgaagccaaggat
ttctacctggcgtcgagccctcccgactcttttctagacgaccagcacctgacctcatct
ggtgcagcagtggctggcatcatcaagccccaccctgagcgtgtacccttcctcttggcg
gagactcctcccaggcctcggcacacactggacgaattgaacccccagaagtccaagcac
cagggtgtaagaagggccaagtggcacctgggtatccgcagtcagagtagacccaatgat
atcatgtcggaagtgtgccgtgccatgaaacagctggattatgagtggaaggttgtgaat
ccatattatttacgtgtgagaaggaagaatcctattactgggatgcaaaccaagatgagc
cttcaactctaccaggtggacagtagaacctacctccttgacttccgtagcatagacgat
gatatgttggagacaaaatctggaactgctacccctctccgctctgggtctgtgggcaac
taccgcaccactattaagaacgatgtagatggggctgacgctccacctacatctagcgtt
gtgcaccccaccaaggcagcagaaggctccttagcttcgtcgttgacctcatccatcgac
tcaacgggagggggggacaacgcgtctgtccctcgaccaggaagccacaccatcgagttc
tttgagatgtgcgcaaatcttattaaactacttgcacgataa

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111670476
Entry
111670476         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111670476
   04068 FoxO signaling pathway
    111670476
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111670476
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111670476
   04920 Adipocytokine signaling pathway
    111670476
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 111670476
NCBI-ProteinID: XP_023282963
LinkDB
Position
Unknown
AA seq 566 aa
MGSTVMESSKQSSKKMPKKRRSLRINMPLLHHTEHHRFQEECKIQALDFGAFASPQVETS
GSTKSAAQTGERLVHSASPTTGLSARSPAGAPLPPCPQSAPVQSKTSSGSPKTIFPYPSH
QNSPPKSPRRLSFSGIFRSSSSSTPASIKIFSRTRRASGLSTPPTTPTQVSSQPVFTQEA
QPSRPSPERLEPSSRSRSLTTPPDTGQRLSLPSAKPPIPSSSPVPSYSTSHQVYGLFEGM
LEKLELDDDAAEPESDIYMRFMKSHKCYDIVPTSSKLVVFDTALQVKKAFFALVANGVRA
APLWDTEKQSFVGMLTITDFIIILHRYYKSPMVQIYELEEHKLETWREVYLQATFKPLVN
ISPDASLFDAVYTLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFMCEMPKPAFMKQ
TLGELGIGTYHDIAFIHPDTPIIKALNIFVERRVSALPVVDDSGKVVDIYSKFDVINLAA
EKAYNNLDITVTQALKHRSQYFEGVVKCHKMETMETIVDRIVKAEVHRLVVVDERSSIEG
IVSLSDILQTLVLSPSDACKEENLTG
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgggaagcacggtgatggagtccagcaagcagagctcaaagaaaatgccaaagaagagg
agaagtctgcggattaacatgccactgctgcatcatacggagcatcatcggtttcaagag
gaatgtaaaatccaggccttggactttggtgcattcgcttcccctcaagttgagacaagt
ggctcaaccaaaagtgcagctcagacgggagagcgtctcgtccattcagccagccccacc
acaggactgtctgcgaggagccctgcaggcgccccgcttcccccctgtccccagtctgct
ccagtgcaatcgaagacgagctcaggttcacccaaaactatcttcccctatccctcccac
cagaactccccacccaagtccccccgccgcctgagcttcagtggtatcttccgctcgtca
tccagctctacaccagcaagcatcaaaatcttctccagaaccaggagagcctctggactc
tccacaccacccaccaccccgacccaggtgtccagccaacctgtgttcacccaggaggcc
cagccgagcaggcccagccctgaacgcttggagccgagctccagatcccgctccctcacc
acacctccagacacaggacagcgtctcagcctcccctctgctaaacccccgatcccttcc
tcaagccctgtgccatcttactctacctcacatcaagtctacggtctattcgaaggcatg
ctggagaaacttgaactagatgatgatgctgctgaacctgagagtgatatttacatgcgc
tttatgaaatcccacaagtgctacgacatcgtcccaacaagctcgaagctggttgtgttc
gacacagcactccaagttaagaaagcgttctttgccttggttgcaaatggtgtgcgagct
gccccactgtgggacacagagaaacaaagttttgtgggaatgctgacaatcacagatttc
atcatcatactacacagatactataagtcaccaatggtgcaaatttatgaattagaggag
cataagcttgagacatggagagaggtttaccttcaagccacattcaaacctctggtcaac
atatcacctgatgcaagcctatttgatgcagtgtacaccctcatcaaaaacaaaattcac
cggctgcctgtcatcgacccagtcacagggaatgcactttatattctcacacacaagagg
atcctcaagttcctccagctctttatgtgtgaaatgccaaagccagctttcatgaagcag
actctcggggagcttggcattggaacgtaccatgacattgctttcatccacccggacacg
cccatcatcaaagcactcaacatctttgtggagagacgagtgtctgctttgccagtggtg
gatgactcgggcaaagttgtggatatttactccaagtttgatgtcattaacttggctgct
gagaaggcatacaacaacctggacattacagtgacgcaggctctgaaacatcgctctcag
tacttcgaaggagtcgtgaagtgccataaaatggaaacaatggagaccattgtggacaga
atagtcaaagccgaagtgcaccggttggtggtggtggacgagcgctccagcatagagggc
atcgtctccctgtcggacatcctccagaccctggtactcagcccttcagatgcctgtaag
gaggagaacctgactgggtga

KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673153
Entry
111673153         CDS       T06058                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04068  FoxO signaling pathway
slal04371  Apelin signaling pathway
slal04530  Tight junction
slal04910  Insulin signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111673153
   04068 FoxO signaling pathway
    111673153
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111673153
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111673153
   04920 Adipocytokine signaling pathway
    111673153
SSDB
Motif
Pfam: CBS Cbl_N3 DUF3562
Other DBs
NCBI-GeneID: 111673153
NCBI-ProteinID: XP_023286596
LinkDB
Position
Unknown
AA seq 378 aa
MPRFSPVGLVPQRQMSHSSSPATEPLPEVPLFEMDQDEDEEEDVLSMKSRGGYIHAIAPP
AGTDPDTFIYMNFMKTHCCYDAIPTSSKLVIFDTTLQVKKAFFALVANGVRAAPLWDSKL
KCFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWREIYLQYSFNSLISITPDSSLF
DAIYSLLKNKIHRLPVIDPASGNVLHILTHKRILKFLHIFGSMIPKPRFLQKRISEVGIG
TFREIATVQESASVYDALTIFVERRVSALPVVNKQGKVVALYSRFDVINLAAQKNYNNLN
MTMREAITSRACCVEGVLKCYPYETLETIIDRIAKAEVHRLVLVDRDDVVRGIVSLSDLL
QALVLTPADIYERPSLQD
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcccaggttttcaccggttggtctggttccacagaggcagatgtcccactcctcttcc
ccagccacggagcctcttccggaggtcccgttatttgagatggaccaggatgaggatgag
gaggaagatgttctctcaatgaagagcagaggtgggtatatacatgctatagcgccccct
gcaggcacagaccctgacaccttcatatacatgaacttcatgaagactcactgctgctac
gacgccatccctaccagctccaaactggtcatctttgacacaacgctacaggtgaagaag
gctttctttgctctggtggctaacggcgtgagggcagcgccgctgtgggacagcaagctt
aagtgttttgtgggtatgctgaccatcactgacttcatcaacattctccatcgttactac
aagtctcctctggttcagatctatgagctggaagagcacaagatagagacgtggagagag
atctatctccagtactcgtttaacagcctgatcagcatcactcccgactccagtctgttt
gacgccatctactccctgttgaagaataagatccaccggctgccggtcatcgacccagcg
tcgggaaacgtcctccacatcctcactcacaaacgcatcctcaagttcctccacatcttc
ggatccatgattcctaaacccaggtttcttcaaaagcgaatcagtgaagtggggatcggc
acctttagagagatcgcgacagtccaggaatcagcgtctgtgtatgacgctctgaccatt
tttgtagagaggagagtgtcagctctgcctgtggttaataagcaaggtaaagtggtggca
ctgtactccaggtttgacgtcattaacctcgcagcccagaaaaactacaacaacctgaac
atgacaatgcgggaggccatcacctccagagcctgctgcgtggaaggagtcctcaagtgt
tacccttatgaaactctggagaccatcattgaccgcattgcgaaggctgaggtgcatcgt
ttggtgttggttgacagggatgatgtggtgagagggattgtttctttatctgacctcctt
caagccctggtcctcactcctgcagatatttatgagagaccatcccttcaagactga

DBGET integrated database retrieval system