KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111644571
Entry
111644571         CDS       T06058                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04068  FoxO signaling pathway
slal04144  Endocytosis
slal04218  Cellular senescence
slal04350  TGF-beta signaling pathway
slal04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111644571
   04350 TGF-beta signaling pathway
    111644571
   04068 FoxO signaling pathway
    111644571
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111644571
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111644571
  09143 Cell growth and death
   04218 Cellular senescence
    111644571
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111644571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111644571
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111644571
Protein kinases [BR:slal01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111644571
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 111644571
NCBI-ProteinID: XP_023249249
LinkDB
Position
Unknown
AA seq 643 aa
MMARCWTFWTGILVLMTAGLPGVVQSFSHLSFNLCKWCEVSSPVCKDSVCMSNCTLSSFC
TVIEEICIAIWRKTNDTMTVHTMCHHPALPLEGVDPGLLLNFTSRECHMVPQPAEDGAMM
VCGCQGEHECNDKLIFNKGANGFFKLQSKDVIPVVVVSLVPPLLVAIVATAAFYFYRTHR
PDKPGPPARPDWPTKRTPELYQALDLPCGGRGSEARGGGGVMAPGSQLEESNAKVSSLNN
DITDWQGQLAEPLPIKLEALVGKGRFAEVWRARLLQGEKGGVNSYETVAVKVFPAVEYAS
WRNECSIFSDPKLEHDNVVQFLAAEERGPPGHTLRKYWLVLAYHSLGNLQDFLTANILSW
EELVVMAGSIAKGLAHLHSDTTPSGIPKVPVAHRDLKSSNIVVKSRKECALCDFGLALRL
DLSLTVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASRCHAI
GEVESYEPAFGSKVCEQPCVDSMRDLVLRDRGRPDIPSAWTQHQGMSVFCSTITECWDHD
PEARLTAHCVVERFNVLQQEQEQEQDQDQDQDQELRPEVGRPEDEERAKNSEKPDNDQVH
SSSTAASSPSSSSSLQVPKPQRDGTEVSHDSPVHTGTGCDLLL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgatggctcggtgctggacgttttggaccgggatcctagtcctcatgaccgccggtctt
ccaggtgtcgtccagtctttcagccacctgagcttcaacctgtgtaagtggtgtgaggtg
tccagtccggtgtgtaaagacagcgtctgcatgagtaactgcaccctgtcgtccttctgc
accgtcatcgaggagatctgcatcgccatatggaggaagaccaacgacacaatgacggtg
cacacgatgtgtcatcatcccgctctgccactagagggcgtcgaccccggcctgctgctc
aacttcacctccagagagtgtcacatggtcccacagccggcagaggacggagccatgatg
gtctgtggctgccagggagaacacgaatgtaacgacaaactgatcttcaacaagggagcc
aacgggttcttcaagctgcagagtaaagacgtgatcccggtggtcgtggttagtttggtg
cctcctctccttgttgccatagttgccaccgccgccttctatttctaccgcacacaccgc
cctgacaaacctggccctcctgcacgccccgactggcccaccaaacgcaccccagagctc
taccaggctttggacctgccatgtggaggccgggggtcggaggccagaggaggaggaggt
gtgatggctcctggatctcagctggaggagtctaatgccaaggtgtcatctctcaacaat
gacatcacagattggcaaggccaattggccgaaccgctgcccatcaaactggaggccctg
gtggggaaggggcgcttcgctgaagtgtggagggcgcgcctgctgcagggcgagaagggc
ggggttaacagctatgaaaccgtggcagtgaaggtgtttcccgctgtggagtacgcctcg
tggagaaacgaatgctccatcttttccgaccccaaactggagcacgacaacgtggtgcag
ttcctggcggctgaagagaggggtccgcccggtcacactctcaggaagtactggctggtc
ttggcctatcacagcctcggcaacctgcaggacttcctcacggcaaacatcctgagctgg
gaggagcttgttgtcatggcaggtagcatcgctaaagggttagctcatctccacagtgac
acgacacccagcgggataccaaaggtgccagtcgcccatcgggacctgaagagcagtaac
atcgtggtgaagagcaggaaggagtgcgctctatgtgactttggtctggccttgagattg
gacctctcgctcactgtcgatgactacgccaacagtggacaggtggggacagctcgctac
atggctcccgaggtactagagtccagggtgaacctggaggacctcgaggcctttaaacag
atggacgtttactccatggctctggtcctctgggaaatggcctcccgctgccacgcaatc
ggagaggtggagagctacgagccggcgtttggctctaaggtgtgtgagcagccctgtgtg
gacagtatgagagacctggtgctgagggacagaggacgtcctgacatcccctcagcctgg
acgcagcatcaggggatgagcgtcttctgctccaccatcactgagtgctgggatcacgac
ccggaggccagactgacggctcactgtgtggtggagcgcttcaacgtcctgcagcaggag
caggagcaggagcaggaccaggaccaggaccaggaccaggaactgagaccagaagttggc
agaccggaggacgaagaaagagcaaagaactctgagaaaccagacaatgaccaggttcat
tcctcctccactgctgcttcctcaccctcctcctcttcctccctccaggttcctaagcca
cagagagacggtacagaggtatcccatgattctccggttcacactggtaccggttgtgac
ctgttactgtaa

DBGET integrated database retrieval system